Dataset for protein Bmf of organism Sinocyclocheilus grahami

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
**::**:                                  .  .. *  .*   .:.: : * :  *  ..  ***   
  de  eqlphccetplrnkssenrdgrggevgqtanrhgrfedrst tas vlnsvrngdm pfqg egdass   avd

        90       100       110       120       130       140       150       160
                      .   ** :::**:*:    *.              . .** :    .:: :     **
artafgvncgtgglasltmapgaseg  alfh  a frahf alfeplldgtqnaeedeg  eekederdvgi-----  

       170       180       190       200       210       220
*  **.**. :**** *:            .  . ..   :    .  ..:         
 iq  r  rem    q e-mqlv-vqsnresslksfplqvytsrcamfsnarisrrhmqi
                   lmhh nirdea  h r ac f ll a le d ganml    
© 1998-2021Legal notice