Dataset for protein Bmf of organism Sinocyclocheilus grahami

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A672RK14_BMF-01      MDDEEDEQLPHCCETPLRNKSSENRDGRGGEVGQTANRHGRFEDRSTQTA
A0A672JWL9_BMF-01      MDEDEDD----------------------------------VRRKGLQHW
A0A672JWL9_BMF-02      MDEDEDD----------------------------------VRRKGLQHW
                       **::**:                                  .  .. *  

A0A672RK14_BMF-01      SSVLNSVRNGDMAPFQGLEGDASSPCRAVDARTAFGVNCGTGGLASLTMA
A0A672JWL9_BMF-01      PSSRVQIKQTETAGIPPLCPSGMLPCR-----------------------
A0A672JWL9_BMF-02      PSSRVQIKQTETAGIPPLCPSGMLPCR-----------------------
                       .*   .:.: : * :  *  ..  ***                       

A0A672RK14_BMF-01      PGASEGPRALFHGNAGFRAHFPALFEPLLDGTQNAEEDEGRPEEKEDERD
A0A672JWL9_BMF-01      --VHVEPRRFLYGNTGLLLLAPP--------------SRSRPPDVVLRQN
A0A672JWL9_BMF-02      --VHVEPRRFLYGNTGLLLLAPP--------------SRSRPPDVVLRQN
                         .   ** :::**:*:    *.              . .** :    .:

A0A672RK14_BMF-01      VGI-----SVEIQIGRKLREMGDQFQQDHLQLVRVISDETSSLW-FSLQW
A0A672JWL9_BMF-01      LRMMDPAESVETLIGQKLQLIGDQFYQEHMMHHRNQRNREPLWWRVAVAF
A0A672JWL9_BMF-02      LRMMDPAESVETLIGQKLQLIGDQFYQD-----------APLHKSVPCAV
                       : :     ***  **.**. :**** *:            .  . ..   

A0A672RK14_BMF-01      FLSRCAMTSSSVISMLHMQI
A0A672JWL9_BMF-01      YTLLFGREPNARANRR----
A0A672JWL9_BMF-02      F-VLAGLFPDSGLVV-----
                       :    .  ..:         

© 1998-2020Legal notice