Dataset for protein classical BH3-containing proteins of organism Saimiri boliviensis boliviensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*                                                                               
Mak----------qpsdvsse-cdr---egrqlqpa---erpp------qlrpgaptslqtepqg-p-------------
 --gmgsawacpciv-qeveslqe-sss-edvfs-stagds--gsgkhr--------da-lhq--n-egssnhggegdve
 fq          e-epcp-- lwd   adqgcete   -gel      rtqvvsll--dsfa sqlts  h  etsspk
 kc          -r fra d t-v   pc-m--s-   v-        gqa  lgg ps---  l         npaa 
 se          d  ---   -lm    -l- gqr   rd        tme  g s  eepe            a    
 p               l    i      t l   q   pa                  a d                  
                                   f                         a                  
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------sc---------------------------------p-g--q-gpl-----pg-f-t------------------
trsrss--msapatdseaqhtenvklealepwrhgvatart-h-sp-l---appas--p-a-rsrsssplfifvrrssvl
mlgkhndy                                 alsrlr fdkthccg slrpgsr  ap vlwgsqlyqrr
e  ha ag                                  akt e ltegwrre a  rav    h n vaae ggge
       d                                  q l     a mee     g                   
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------drspapmscdkstqtp--sppcqafnhylsam------------------------------------
srsssgyfsfdt-------qsg-a---lar----p---------asmrqqrsfygnagyrlplpasfpavlplgqaepag
l rmpvt arhpqtles v-e-tgspm-sqgsas-sqgvm pcgvteep  l  ap epkscvv     gp  peqpssf
   l de vpsflsv r pt-mq- dar gk tqarp      qgvwtm  d                     avrgiee
         d  kh  g lplhpn  kk    q   d      adriig                         sgdepa
            eg  d keaahh   a                 ia e                         r a l 
                  ia  g                      e                            i   g 
                      e                      d                            a     
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------e------lr-i-d-f-----------------------------------------------------------
qwgmrp-iwiaqe--r-g-e-naylyrprrvflnnyqaaedhphlafildrtdirdvlsgvvdvfadfqedivrvwlsls
elqhkaavqlgrqtqcmatqldrr ghvqqrpyqppkqttynrs                             mpiw   
d rr r wec lwfgvftswwhvl h ggslsspqhev  tlhn                              lgr   
  al q rg  ak afcqrpv ls l sakiqehlsdg  qsag                              a d   
       da  s   a f km fq d r gclaehq    hr                                      
           i       f   n   e  ae                                                
           g       d   h                                                        
                                                                                
                                                                                
                                                                                
                                                                                

       330       340       350     
....:....|....:....|....:....|....:
                                   
----------------------------------h
sgswvsgkqarllryivnlllmfnggerrlvwrpv
          vvynllhl ap  srelnqngagms
          q clfptk fc  p  h ewpmyvr
          f  qg sg  a       apllvsk
             gc m            iekste
             a  l              flld
                a              ekgt
                                efq
                                 cn
                                  m
                                  g
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice