Dataset for protein classical BH3-containing proteins of organism Saimiri boliviensis boliviensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------makqpsdvssecdregrqlqpaerpp------qlrpga----------------------
mkcgmgsawacpcqmfqipe--pseqqmvesledg--pstaedsevgsgkhr-----sllsadlfaqslldcplsrlqlf
              vprassfeme-cedpgtarsdlsvfltgrgvd      rtqhsl                      
                    lt-vs--cclkspilsttpshlqf a      gqa  -                      
                      w- e r   raakmlae c  a         sh  t                      
                       m       q  aae                                           
                               k    a                                           
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
Ptslqtepqgnpegnhggegdscphgspqgpla-p------a-r------------------------tdrs----papm
-lthshgqg----s-------------------p-aspgpf-t-splfifvrrssvlsrsssgyfsfd--g-kgwrrl-v
 gdaccq--qptt-sedkatqtlspagrsqgvmlqcgvteepqdvsyvqleasqpyvvgvytprlpygna-ygrre--sl
 -a----gtlrrseqrhsgeswaeerenhsar sdpatisyqrhtfnrprrplhlwrhata agyfqsrr teimdvsea
  -mevv  sdap vqlevnppvrtm kansg aallndqdem leklkadlkec ea p    taaill qd l tr -
    aq    a d dp   cgapkml h lr    d caa    aa aa   a               ee d    se s
     g        a    a    ci a d                                              e  g
                                                                            d   
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
scdkstqtp---sppcqafnhylsam-------asmr-------------------------------------------
pfsfqarrqlgepdtlgqwqnlgrglwvsgtss----qsqaepagmrpeiwiaqelrrigdefnayyprrvflnnyqarg
-vrvpwvllqprq--erllgdraevqfeatkqavafklevvadqmwllhvqqhlqnynrvwwqvllflhnlawsgeenae
vagrvseskghp-sn-a-ayswims-dc  g  lrrsrqcidssfhsrrsstlgtatqyrqssswtrviqsyvprnlgsn
t-aprrgqh dklniw-v-srmshts       ivlpmlirvlllgpnkprsffk  gmhh  gteq  hkwkdpd  q 
qp-ihpdff   eafvwshref ckr       rpwleghqlifkffgglkl  d               is        
l  gfla a      s kgl   aee       kliiddflc eee af f                    e        
e  deg         r                 giee  ag                                       
d  a e         i                  d d                                           
                                  c a                                           

       250       260  
....:....|....:....|..
                      
----------------------
ghppmvilrllryivrlvwrmh
daghrqfrcv            
 stqsp                
 la i                 
                      
                      
                      
                      
                      
© 1998-2022Legal notice