Dataset for protein classical BH3-containing proteins of organism Saimiri boliviensis boliviensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------------c-lsrlqsfplthc--cgrglsPst---------qedkl
mepsqcveeleddvfqpedgepgtqpgsllsadlfaqsllm-qmpkqsldvssesssaepqvrltsmevagdspprspqa
                             mkcgmgsawacdfpiaefppseqmptdrersspq ae   v grd gpgph
                                        pse----e----edgqm  qfad lp     a a adqhv
                                           vrpa- ltwv  ll  k     l         e led
                                           d      i    kk                       
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
rqtlppa-------lpgglteepqqlfysnhg----------------------p-----p---w-r--e----r-----
t---s--spsqgvm-rcsvstqqgrptsgsa-grlpscphgspqglpasfsavs-lleqp-ggq-q-ra-vqireklqpf
erqaqlrrmgnslgfatdaqhlit------rhyenq         slktvpvalsggaatlefegahkvswgva-vssdi
svpv gecfedkdn  qq aniasknpvav-erggg         qvypratygayptrsetdtfvqhtlsvsvsspgcw
 sei s       a  lk lgg dgmdp ptae ed         paempvsp  pmsgqalrsereesgnlrsdmfeyl
 cad             a  c    aae l    aa         a  el rh  fapfi d idm dq a ll ead  
                           c g                   c k             i  i   k  a a  

       170       180       190       200       210       220       230     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
                                                                           
-----r---p------r-rpwp-r-lfnh-lsl-g------ag-r------------------------------
rdqfh-srv-qswqqs-qg-s-w-q---ly-a-n-eprrns--p-tqmrqssswtrvssswwdrnlgrggsapsq
ahgydtlpaqmlcdkntn-v-wqvlsyl-nm-amalenpsgsplmspvqcple lakiq                
sfdvv rhtenh rsqsyttkvpcvapvfvglvrpfwtgptlathrlnka                         
qe ts aaq    eapqs selsgrqde ldgflldrhmkrg qalela                          
na re   p    a l r r gr m aa ia  kd ld h   e ed                            
   ia          g h      k    f   a  aa f                                   
© 1998-2020Legal notice