Dataset for protein classical BH3-containing proteins of organism Saimiri boliviensis boliviensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

20 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6S6C4_PMAIP1-      ---------------------------MPGKKARKSAQPSPARAPA----
A0A2K6TW78_BMF-03       ----------------------MEPSQCVEELEDD--VFQPEDGEP----
A0A2K6TW78_BMF-01       ----------------------MEPSQCVEELEDD--VFQPEDGEP----
A0A2K6TW78_BMF-02       ----------------------MEPSQCVEELEDD--VFQPEDGEP----
A0A2K6STD6_BBC3-01      MKCGMGSAWACPCQVPRASSLTWVPCQMCETRRAAATPPLTLEGPV----
A0A2K6TBD7_BIK-01       ---------------------MSEDRPLSSDILMETLLCEQFVDPLTMEV
A0A2K6STD6_BBC3-02      MKCGMGSAWACPCQVPRASSLTWVPCQMCGSQPSLSLAEQHLESPV----
A0A2K6TRJ7_BCL2L11      --------------------MAKQPSDVSSECDREGRQLQPAERPP----
A0A2K6TRJ7_BCL2L11      --------------------MAKQPSDVSSECDREGRQLQPAERPP----
A0A2K6TRJ7_BCL2L11      --------------------MAKQPSDVSSECDREGRQLQPAERPP----
A0A2K6TRJ7_BCL2L11      --------------------MAKQPSDVSSECDREGRQLQPAERPP----
A0A2K6TRJ7_BCL2L11      --------------------MAKQPSDVSSECDREGRQLQPAERPP----
A0A2K6TRJ7_BCL2L11      --------------------MAKQPSDVSSECDREGRQLQPAERPP----
A0A2K6TRJ7_BCL2L11      --------------------MAKQPSDVSSECDREGRQLQPAERPP----
A0A2K6TRJ7_BCL2L11      --------------------MAKQPSDVSSECDREGRQLQPAERPP----
A0A2K6TRJ7_BCL2L11      --------------------MAKQPSDVSSECDREGRQLQPAERPP----
A0A2K6TRJ7_BCL2L11      --------------------MAKQPSDVSSECDREGRQLQPAERPP----
A0A2K6TG62_BAD-01       --------------MFQIPEFEPSEQEDSSSAERGLSPSTAGDSPPGSGK
A0A2K6TG62_BAD-03       --------------MFQIPEFEPSEQEDSSSAERGLSPSTAGDSPPGSGK
A0A2K6TG62_BAD-02       --------------MFQIPEFEPSEQEDSSSAERGLSPSTAGDSPPGSGK
                                                                          

A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2K6TW78_BMF-03       --GTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKAT
A0A2K6TW78_BMF-01       --GTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKAT
A0A2K6TW78_BMF-02       --GTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKAT
A0A2K6STD6_BBC3-01      --QSHHGT----------------------P-ALSQGPQSPRDGAQLGAC
A0A2K6TBD7_BIK-01       VGGSDPEE----------------------DPDSVEDPL-----------
A0A2K6STD6_BBC3-02      -----PSA----------------------PGALAGGPTQAAPGVRGEEE
A0A2K6TRJ7_BCL2L11      --QLRPGA----------------------PTSLQTEPQ-----------
A0A2K6TRJ7_BCL2L11      --QLRPGA----------------------PTSLQTEPQGNPEGNHGGEG
A0A2K6TRJ7_BCL2L11      --QLRPGA----------------------PTSLQTEPQGNPEGNHGGEG
A0A2K6TRJ7_BCL2L11      --QLRPGA----------------------PTSLQTEPQGNPEGNHGGEG
A0A2K6TRJ7_BCL2L11      --QLRPGA----------------------PTSLQTEPQGNPEGNHGGEG
A0A2K6TRJ7_BCL2L11      --QLRPGA----------------------PTSLQTEPQGNPEGNHGGEG
A0A2K6TRJ7_BCL2L11      --QLRPGA----------------------PTSLQTEPQGNPEGNHGGEG
A0A2K6TRJ7_BCL2L11      --QLRPGA----------------------PTSLQTEPQGNPEGNHGGEG
A0A2K6TRJ7_BCL2L11      --QLRPGA----------------------PTSLQTEPQ-----------
A0A2K6TRJ7_BCL2L11      --QLRPGA----------------------PTSLQTEPQ-----------
A0A2K6TG62_BAD-01       HRRQAPGL----------------------PGDASHQQGQPTSSSHHGGA
A0A2K6TG62_BAD-03       HRRQAPGL----------------------PGDASHQQGQPTSSSHHGEN
A0A2K6TG62_BAD-02       HRRQAPGL----------------------PGDASHQQGQPTSSSHHGGT
                                                                          

A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2K6TW78_BMF-03       QTLSPASPSQGVMLPCGVTEEPQRL------------------FYAPAE-
A0A2K6TW78_BMF-01       QTLSPASPSQGVMLPCGVTEEPQRL------------------FYGNAGY
A0A2K6TW78_BMF-02       QTLSPASPSQGVMLPCGVTEEPQRL------------------FYGNAGY
A0A2K6STD6_BBC3-01      --------------------------------------------------
A0A2K6TBD7_BIK-01       -ECMENSDALALQLACIADQMDVSLRARRLAQLYEVATYSPGLAFILDRT
A0A2K6STD6_BBC3-02      QWAREIGAQLRRMADDLNAQYERRRQ------------------------
A0A2K6TRJ7_BCL2L11      -------------------------------------------------D
A0A2K6TRJ7_BCL2L11      DSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTD
A0A2K6TRJ7_BCL2L11      DSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTD
A0A2K6TRJ7_BCL2L11      DSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTD
A0A2K6TRJ7_BCL2L11      DSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTD
A0A2K6TRJ7_BCL2L11      DSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTD
A0A2K6TRJ7_BCL2L11      DSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTD
A0A2K6TRJ7_BCL2L11      DSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTD
A0A2K6TRJ7_BCL2L11      -------------------------------------------------D
A0A2K6TRJ7_BCL2L11      -------------------------------------------------D
A0A2K6TG62_BAD-01       GAVETRSRHSS---------------------------------YPAGTE
A0A2K6TG62_BAD-03       PSAKMLSKASAGMSAPATDSEAQHTENVKLEALEPWRHGVATARTPQGRR
A0A2K6TG62_BAD-02       SSPEERGHSNA------------DAAKLQLDASHPVLVG--------SEL
                                                                          

A0A2K6S6C4_PMAIP1-      ------DLEVECAIQLRRFGDKLNFR---QKLLNLISKLFCSGT------
A0A2K6TW78_BMF-03       ----PKSCVVAGPPLPAQPGFEWRRK---QEWGRSE--------------
A0A2K6TW78_BMF-01       RLPLPASFPAVLPLGEQPPEGQWQHR---AEVQIARKLQCIADQFHRLHV
A0A2K6TW78_BMF-02       RLPLPASFPAVLPLGEQPPEGQWQHR---AEVQIARKLQCIADQFHRLHV
A0A2K6STD6_BBC3-01      ------TRPVDVRDSGGRPLPPPDTLASAGDFLCTM--------------
A0A2K6TBD7_BIK-01       DI-------------RDVLSGVVDVF---ADFQEDI-------VRLWRSL
A0A2K6STD6_BBC3-02      ------------EEQPQHRPSPWRVL---YNLIMGL-------LPFPRGH
A0A2K6TRJ7_BCL2L11      RS----PAPMSCDKSTQTPSPPCQAF---NHYLSAM-------ASMRQSQ
A0A2K6TRJ7_BCL2L11      RS----PAPMSCDKSTQTPSPPCQAF---NHYLSAM-------VREIEEV
A0A2K6TRJ7_BCL2L11      RS----PAPMSCDKSTQTPSPPCQAF---NHYLSAM-------ADWD---
A0A2K6TRJ7_BCL2L11      RS----PAPMSCDKSTQTPSPPCQAF---NHYLSAM-------GIFE---
A0A2K6TRJ7_BCL2L11      RS----PAPMSCDKSTQTPSPPCQAF---NHYLSAM-------ASMRQSQ
A0A2K6TRJ7_BCL2L11      RS----PAPMSCDKSTQTPSPPCQAF---NHYLSAM-------ASMRQSQ
A0A2K6TRJ7_BCL2L11      RS----PAPMSCDKSTQTPSPPCQAF---NHYLSAM-------ASMRQSQ
A0A2K6TRJ7_BCL2L11      RS----PAPMSCDKSTQTPSPPCQAF---NHYLSAM-------ASMRQSQ
A0A2K6TRJ7_BCL2L11      RS----PAPMSCDKSTQTPSPPCQAF---NHYLSAM-------VVIRMDI
A0A2K6TRJ7_BCL2L11      RS----PAPMSCDKSTQTPSPPCQAF---NHYLSAMDEATGSSLALRREV
A0A2K6TG62_BAD-01       GDEGMEEEPSPFRGRSRSAPPNLWAA---QRYGREL-------RRMSDEF
A0A2K6TG62_BAD-03       GTKGWRRSPALFGAVRARHPPTSGQH---SDMAAS---------------
A0A2K6TG62_BAD-02       GQGRLRSLPVTFAPHPETLPAPIALG---GHLGHGR-------KCFL---
                                                                          

A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2K6TW78_BMF-03       --------------------------------------------------
A0A2K6TW78_BMF-01       QQHQQNRNRVWWQVLLFLHNLALNGEENRNGAGPR---------------
A0A2K6TW78_BMF-02       QQHQQNRNRVWWQVLLFLHNLALNGEENRNGAGPR---------------
A0A2K6STD6_BBC3-01      --------------------------------------------------
A0A2K6TBD7_BIK-01       SSGSWVSGKQAVLLALLALLLAMFSGGLRLLLK-----------------
A0A2K6STD6_BBC3-02      RAPEMEPN------------------------------------------
A0A2K6TRJ7_BCL2L11      AEPAGMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEDHPHMVILRL
A0A2K6TRJ7_BCL2L11      VV------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      AEPAGMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEDHPHMVILRL
A0A2K6TRJ7_BCL2L11      AEPAGMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEDHPHMVILRL
A0A2K6TRJ7_BCL2L11      AEPAGMRPEIWIAQELRRIGDEFNAYYPRRLEK-----------------
A0A2K6TRJ7_BCL2L11      AEPAGMRPEIWIAQELRRIGDEFNAYYPRRISLPPD--------------
A0A2K6TRJ7_BCL2L11      GDISLWFRFIFTFFDLYGYHHSQGTEQLHHKYVS----------------
A0A2K6TRJ7_BCL2L11      QCPLEWLAKSS---------------------------------------
A0A2K6TG62_BAD-01       VDSFKGLPRPKSAGTATQMRQSSSWTRVIQSWWDRNLGRGGSAPSQ----
A0A2K6TG62_BAD-03       --------------------------------------SGG---------
A0A2K6TG62_BAD-02       --------------------------------------QGGLTQIPFRCV
                                                                          

A0A2K6S6C4_PMAIP1-      ------------
A0A2K6TW78_BMF-03       ------------
A0A2K6TW78_BMF-01       ------------
A0A2K6TW78_BMF-02       ------------
A0A2K6STD6_BBC3-01      ------------
A0A2K6TBD7_BIK-01       ------------
A0A2K6STD6_BBC3-02      ------------
A0A2K6TRJ7_BCL2L11      LRYIVRLVWRMH
A0A2K6TRJ7_BCL2L11      ------------
A0A2K6TRJ7_BCL2L11      ------------
A0A2K6TRJ7_BCL2L11      ------------
A0A2K6TRJ7_BCL2L11      LRYIVRLVWRMH
A0A2K6TRJ7_BCL2L11      LRYIVRLVWRMH
A0A2K6TRJ7_BCL2L11      ------------
A0A2K6TRJ7_BCL2L11      ------------
A0A2K6TRJ7_BCL2L11      ------------
A0A2K6TRJ7_BCL2L11      ------------
A0A2K6TG62_BAD-01       ------------
A0A2K6TG62_BAD-03       ------------
A0A2K6TG62_BAD-02       ------------
                                    

© 1998-2021Legal notice