Dataset for protein classical BH3-containing proteins of organism Saimiri boliviensis boliviensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2K6TBD7_BIK-01       ----------------------------------------MSEDRPLSSD
A0A2K6TG62_BAD-03       ----------------------------------------MFQIPEFEPS
A0A2K6TG62_BAD-01       ----------------------------------------MFQIPEFEPS
A0A2K6TW78_BMF-03       MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLF
A0A2K6TW78_BMF-02       MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLF
A0A2K6TW78_BMF-01       MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLF
A0A2K6STD6_BBC3-02      -----------------------------MKCGMGSAWACPCQVPRASSL
A0A2K6TRU4_BCL2L11      -------------------------------------------MAKQPSD
A0A2K6TRU4_BCL2L11      -------------------------------------------MAKQPSD
                                                                          

A0A2K6S6C4_PMAIP1-      --MPGKKARKSAQPSP-----ARAPADLEVECAIQLRRFGDKLNFRQKLL
A0A2K6TBD7_BIK-01       ILMETLLCEQFVDPLTMEVVGGSDPEEDPDSVEDPLECMENSDALALQLA
A0A2K6TG62_BAD-03       EQEDSSSAERGLSPST---AGDSPPGSGKHRRQAP--------GLPGDAS
A0A2K6TG62_BAD-01       EQEDSSSAERGLSPST---AGDSPPGSGKHRRQAP--------GLPGDAS
A0A2K6TW78_BMF-03       PLTHC--CGPGLRPTS---------QEDKATQTLSPASPSQGVMLPCGVT
A0A2K6TW78_BMF-02       PLTHC--CGPGLRPTS---------QEDKATQTLSPASPSQGVMLPCGVT
A0A2K6TW78_BMF-01       PLTHC--CGPGLRPTS---------QEDKATQTLSPASPSQGVMLPCGVT
A0A2K6STD6_BBC3-02      TWVPCQMCGSQPSLSL---------AEQHLESPVPSA--------PGALA
A0A2K6TRU4_BCL2L11      VSSECDREGRQLQPAE---------RPPQLR---PGA--------PTSLQ
A0A2K6TRU4_BCL2L11      VSSECDREGRQLQPAE---------RPPQLR---PGA--------PTSLQ
                                                                          

A0A2K6S6C4_PMAIP1-      NLISKLFCSGT---------------------------------------
A0A2K6TBD7_BIK-01       CIADQMDVSLRARRLA---------QLYEVATYSPGLAFILDRTDIRDVL
A0A2K6TG62_BAD-03       HQQGQPTSSSHHGENP---------SAKMLSKASAGMSAPATDSEAQHTE
A0A2K6TG62_BAD-01       HQQGQPTSSSHHGGAG---------AVETRSRHSSYPAGTEGDEGME---
A0A2K6TW78_BMF-03       EEPQRLFYAPAE--------------PKSCVVAGPPLPAQPGFEWRRKQE
A0A2K6TW78_BMF-02       EEPQRLFYGNAGYRLP---------LPASFPAVLPLGEQPPEGQWQHRAE
A0A2K6TW78_BMF-01       EEPQRLFYGNAGYRLP---------LPASFPAVLPLGEQPPEGQWQHRAE
A0A2K6STD6_BBC3-02      GGPTQAAPGVRGEEEQ----------------------------WAREIG
A0A2K6TRU4_BCL2L11      TEPQ----------------------------------------------
A0A2K6TRU4_BCL2L11      TEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSS
                                                                          

A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2K6TBD7_BIK-01       SGVVDVFADFQEDIVR-----LWRSLSSGSWVSGKQAVLLALLALLLAMF
A0A2K6TG62_BAD-03       NVKLEALEPWRHGVATARTPQ----GRRGTKGWRRSPALFGAVRA-RHPP
A0A2K6TG62_BAD-01       ----EEPSPFR-GRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPK
A0A2K6TW78_BMF-03       WGRSE---------------------------------------------
A0A2K6TW78_BMF-02       VQIARKLQCIADQFHRLHVQQH-QQNRNRVWWQVLLFLHNLALNGEENRN
A0A2K6TW78_BMF-01       VQIARKLQCIADQFHRLHVQQH-QQNRNRVWWQVLLFLHNLALNGEENRN
A0A2K6STD6_BBC3-02      AQLRRMADDLNAQYERRRQE---EQPQHRPSPWRVLYNLIMGLLPFPRGH
A0A2K6TRU4_BCL2L11      --------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDEATGS
A0A2K6TRU4_BCL2L11      VLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMADWD--
                                                                          

A0A2K6S6C4_PMAIP1-      -----------------------------------
A0A2K6TBD7_BIK-01       SGGLRLLLK--------------------------
A0A2K6TG62_BAD-03       TSGQHSDMAASS----------------GG-----
A0A2K6TG62_BAD-01       SAGTATQMRQSSSWTRVIQSWWDRNLGRGGSAPSQ
A0A2K6TW78_BMF-03       -----------------------------------
A0A2K6TW78_BMF-02       GAGPR------------------------------
A0A2K6TW78_BMF-01       GAGPR------------------------------
A0A2K6STD6_BBC3-02      RAPEMEPN---------------------------
A0A2K6TRU4_BCL2L11      SLALRREVQCPLEWLAKSS----------------
A0A2K6TRU4_BCL2L11      -----------------------------------
                                                           

© 1998-2020Legal notice