Dataset for protein classical BH3-containing proteins of organism Saimiri boliviensis boliviensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

20 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6S6C4_PMAIP1-      --------------MPGKKARKSAQPSPARAPADLE--------------
A0A2K6STD6_BBC3-01      MKCGMGSAWACPCQVPRASSLTWVPCQMCETRRAAA-----------TPP
A0A2K6TW78_BMF-03       ---------MEPSQCVEELEDD--VFQPEDGEPGTQ----------PGSL
A0A2K6TBD7_BIK-01       --------------------------MSEDRPLSSDILMETLLCEQFVDP
A0A2K6TG62_BAD-01       -MFQIPEFEPSEQEDSSSAERGLSPSTAGDSPPGSG-KHRRQAPGLPGDA
A0A2K6TG62_BAD-03       -MFQIPEFEPSEQEDSSSAERGLSPSTAGDSPPGSG-KHRRQAPGLPGDA
A0A2K6TG62_BAD-02       -MFQIPEFEPSEQEDSSSAERGLSPSTAGDSPPGSG-KHRRQAPGLPGDA
A0A2K6STD6_BBC3-02      MKCGMGSAWACPCQVPRASSLTWVPCQMCGSQPSLSLAEQHLESPVPSAP
A0A2K6TW78_BMF-02       ---------MEPSQCVEELEDD--VFQPEDGEPGTQ----------PGSL
A0A2K6TW78_BMF-01       ---------MEPSQCVEELEDD--VFQPEDGEPGTQ----------PGSL
A0A2K6TRJ7_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLR----------PGAP
A0A2K6TRJ7_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLR----------PGAP
A0A2K6TRJ7_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLR----------PGAP
A0A2K6TRJ7_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLR----------PGAP
A0A2K6TRJ7_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLR----------PGAP
A0A2K6TRJ7_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLR----------PGAP
A0A2K6TRJ7_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLR----------PGAP
A0A2K6TRJ7_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLR----------PGAP
A0A2K6TRJ7_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLR----------PGAP
A0A2K6TRJ7_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLR----------PGAP
                                                                          

A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2K6STD6_BBC3-01      LTLEGPVQSHHGTPALSQGPQSPRDGAQL---------------------
A0A2K6TW78_BMF-03       LSADLFAQSLLD---------CPLSRLQLFPLTHCCGPGLRPTSQE----
A0A2K6TBD7_BIK-01       LTMEVVGGSDPEEDP-----------------------------------
A0A2K6TG62_BAD-01       SHQQGQPTSSSHHGGAGAVETRSRHSS-----------------------
A0A2K6TG62_BAD-03       SHQQGQPTSSSHHGENPSAKMLSKASAGMSAPATDSEAQHTENVKLEALE
A0A2K6TG62_BAD-02       SHQQGQPTSSSHHGGTSSPEERGHSNA------------DAAKLQLDASH
A0A2K6STD6_BBC3-02      GALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLN-------------
A0A2K6TW78_BMF-02       LSADLFAQSLLD---------CPLSRLQLFPLTHCCGPGLRPTSQE----
A0A2K6TW78_BMF-01       LSADLFAQSLLD---------CPLSRLQLFPLTHCCGPGLRPTSQE----
A0A2K6TRJ7_BCL2L11      TSLQTEPQ------------------------------------------
A0A2K6TRJ7_BCL2L11      TSLQTEPQ------------------------------------------
A0A2K6TRJ7_BCL2L11      TSLQTEPQ------------------------------------------
A0A2K6TRJ7_BCL2L11      TSLQTEPQGNPEGNHGGEGDSCPHGSPQG-PLAPPASPGPFATRSPLFIF
A0A2K6TRJ7_BCL2L11      TSLQTEPQGNPEGNHGGEGDSCPHGSPQG-PLAPPASPGPFATRSPLFIF
A0A2K6TRJ7_BCL2L11      TSLQTEPQGNPEGNHGGEGDSCPHGSPQG-PLAPPASPGPFATRSPLFIF
A0A2K6TRJ7_BCL2L11      TSLQTEPQGNPEGNHGGEGDSCPHGSPQG-PLAPPASPGPFATRSPLFIF
A0A2K6TRJ7_BCL2L11      TSLQTEPQGNPEGNHGGEGDSCPHGSPQG-PLAPPASPGPFATRSPLFIF
A0A2K6TRJ7_BCL2L11      TSLQTEPQGNPEGNHGGEGDSCPHGSPQG-PLAPPASPGPFATRSPLFIF
A0A2K6TRJ7_BCL2L11      TSLQTEPQGNPEGNHGGEGDSCPHGSPQG-PLAPPASPGPFATRSPLFIF
                                                                          

A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2K6STD6_BBC3-01      -------------------GACTRPVDVRDSGGRPLPPPDTLAS------
A0A2K6TW78_BMF-03       -------------------DKATQTLSPASPSQGVMLPCGVTEEPQRLF-
A0A2K6TBD7_BIK-01       -------------------DSVEDPLECMENSDALALQLACIAD------
A0A2K6TG62_BAD-01       ----------YPAGTEGDEGMEEEPSPFRGRSRSAPPNLWAAQR------
A0A2K6TG62_BAD-03       PWRHGVATARTPQGRRGTKGWRRSPALFGAVRARHPPTSGQHSD------
A0A2K6TG62_BAD-02       PVLVG--------SELGQGRLRSLPVTFAPHPETLPAPIALGGH------
A0A2K6STD6_BBC3-02      -------------------AQYERRRQEEQPQHRPSPWRVLYNL------
A0A2K6TW78_BMF-02       -------------------DKATQTLSPASPSQGVMLPCGVTEEPQRLFY
A0A2K6TW78_BMF-01       -------------------DKATQTLSPASPSQGVMLPCGVTEEPQRLFY
A0A2K6TRJ7_BCL2L11      -------------------DRSPAPMSCDKSTQTPSPPCQAFNH------
A0A2K6TRJ7_BCL2L11      -------------------DRSPAPMSCDKSTQTPSPPCQAFNH------
A0A2K6TRJ7_BCL2L11      -------------------DRSPAPMSCDKSTQTPSPPCQAFNH------
A0A2K6TRJ7_BCL2L11      VRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNH------
A0A2K6TRJ7_BCL2L11      VRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNH------
A0A2K6TRJ7_BCL2L11      VRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNH------
A0A2K6TRJ7_BCL2L11      VRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNH------
A0A2K6TRJ7_BCL2L11      VRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNH------
A0A2K6TRJ7_BCL2L11      VRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNH------
A0A2K6TRJ7_BCL2L11      VRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNH------
                                                                          

A0A2K6S6C4_PMAIP1-      ---------------------------------VECAIQLRRFGDKLNFR
A0A2K6STD6_BBC3-01      ---------AGDFLCTM---------------------------------
A0A2K6TW78_BMF-03       ------------YAPAEPKSCVVAGPPLPAQPGFEWRRKQEWGRSE----
A0A2K6TBD7_BIK-01       ---QMDVSLRARRLAQLYEVATYSPGLAFILDRTDIRDVLSGVVDVFADF
A0A2K6TG62_BAD-01       ------------YGRELRRMSDEFVDSFKGLPRPKSAGTATQMRQSSSWT
A0A2K6TG62_BAD-03       ------------MAAS----------------------------------
A0A2K6TG62_BAD-02       ------------LGHGRKCFL-----------------------------
A0A2K6STD6_BBC3-02      ------------IMGLLPFPRGHRAPEMEPN-------------------
A0A2K6TW78_BMF-02       GNAGYRLPLPASFPAVLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRL
A0A2K6TW78_BMF-01       GNAGYRLPLPASFPAVLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRL
A0A2K6TRJ7_BCL2L11      ------------YLSAM---DEATGSSLALRREVQCPLEWLAKSS-----
A0A2K6TRJ7_BCL2L11      ------------YLSAMVVIRMDIGDISLWFRFIFTFFDLYGYHHSQGTE
A0A2K6TRJ7_BCL2L11      ------------YLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDEFNAY
A0A2K6TRJ7_BCL2L11      ------------YLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDEFNAY
A0A2K6TRJ7_BCL2L11      ------------YLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDEFNAY
A0A2K6TRJ7_BCL2L11      ------------YLSAMVREIEEVVV------------------------
A0A2K6TRJ7_BCL2L11      ------------YLSAMGIFE-----------------------------
A0A2K6TRJ7_BCL2L11      ------------YLSAMADWD-----------------------------
A0A2K6TRJ7_BCL2L11      ------------YLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDEFNAY
A0A2K6TRJ7_BCL2L11      ------------YLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDEFNAY
                                                                          

A0A2K6S6C4_PMAIP1-      QKLLNLISKLFCSGT-----------------------------
A0A2K6STD6_BBC3-01      --------------------------------------------
A0A2K6TW78_BMF-03       --------------------------------------------
A0A2K6TBD7_BIK-01       QEDIVRLWRSLSSGSWVSGKQAVLLALLALLLAMFSGGLRLLLK
A0A2K6TG62_BAD-01       RVIQSWWDRNLGRGGSAPSQ------------------------
A0A2K6TG62_BAD-03       ------------SGG-----------------------------
A0A2K6TG62_BAD-02       ------------QGGLTQIPFRCV--------------------
A0A2K6STD6_BBC3-02      --------------------------------------------
A0A2K6TW78_BMF-02       HVQQHQQNRNRVWWQVLLFLHNLALNGEENRNGAGPR-------
A0A2K6TW78_BMF-01       HVQQHQQNRNRVWWQVLLFLHNLALNGEENRNGAGPR-------
A0A2K6TRJ7_BCL2L11      --------------------------------------------
A0A2K6TRJ7_BCL2L11      QLHHKYVS------------------------------------
A0A2K6TRJ7_BCL2L11      YPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH--------
A0A2K6TRJ7_BCL2L11      YPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH--------
A0A2K6TRJ7_BCL2L11      YPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH--------
A0A2K6TRJ7_BCL2L11      --------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------
A0A2K6TRJ7_BCL2L11      YPRRISLPPD----------------------------------
A0A2K6TRJ7_BCL2L11      YPRRLEK-------------------------------------
                                                                    

© 1998-2021Legal notice