Dataset for protein classical BH3-containing proteins of organism Rhinopithecus bieti

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------------------------------makqpsdvssecdregrqlqpae
msgvrpvsrdilmetllyeqllepltmevlgvtdpeedmfqipefepseqedsssae--me--r------d----prdgp
                                      ldpmed d l cmeertwsrgl-rt-cverle-svfh-eq-k
                                                  lad dm l -glgpagdppsvdrkrhm- -
                                                           as aclaa mvagl as-l q
                                                            r  ai   g       g  i
                                                            p                   
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
rppqlrpgaptslqtepqgnped--nhggegdscphgspqgpl--pasp---a--sp----mr-ssl-------------
-ga-pg-sl-adafaqsl---p-sr------------------ap----gpf-tr--lfif--r---lsrsssgyfsfdt
pa-k--s--s-r-lydasldc-qptlqlfplthtcgpglrptsqedkatqtlgpaeesqgvrlpcgvteepqrlfygnag
k-rvnaqpsrlgf-w---hqqrlvlssshhsgtpavevtsrlwyyssgseesenpaarplafasrlrphl rgpeeqvqv
lsssrmmarg - i-rrtvtigtegwprrl plmqrhtrm kksl rerpdd gm  emspe gp m a    h  appl
g qla h    n   gqrreeava t fmd iggll ni  h l      aa     al     a               
  e        a    led a    d a   fa  k f   f                                      
                 a                       a                                      
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
drspapmscdkstq--------------------------tpsppcqafnhylsamas-rrqaepadmrp--ri-q-lrr
------a--q--lpevsarpppgligvgrtwsrgaspgaiglq-legqwqlraevliaipkl--------ei--a-e---
yalslv-afpav--                         l-e-r-aells-g-klqwrg---qcaptqfhrlhvqshqqn
spprvlsra-vyrr                          q-rlwgd---s-s-g-vl wngtaigepettrqtviwtlw
n watdyet rqwh                          rtl m--tyvrsqq-kpv nlepvsv gtrnq ssgtsev
g g qcw e gpga                          lgg fsvpvkgimlt ln iivktvk ciqm  ardfr t
a   n     el                            e e  rangefefh  nk fg hs   a gg   k  a s
    g      i                            a      k  ddeg  gi ee fr          g     
                                               e           ad e                 
                                                              d                 

       250       260       270       280       290       300       310
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                      
-g--------------------------------------------------------------------
i-defnayyarrvflrvywqildhpqnvilrllryrvgavwrmhtwrgsrgrtlppprtmcsagdflctm
rnswwtrrlpyvlsknnwqaaelflhmlasngeeninrlgp pvdvndggcqp lkgdllal        
fqptghqpellpswvpshsstqattggpqrprsgaql  ct  l                          
pafiadpndg lmtsyqqyhsp ss lnh dfn                                     
c af aglae ghpnwpdhgma le                                             
   a   f   egeiqla d                                                  
             cali                                                     
             a g                                                      
                                                                      
© 1998-2022Legal notice