Dataset for protein classical BH3-containing proteins of organism Rhinopithecus bieti

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------p---------e--vfqpeegepgaqpgas----------------------------pglrptpqgdrptqtl
msgmfqq-epsrceeel-dd-le-ad-pds--srselsadlfaqslldcplsrlqlfplthccgtspgtssaerka---g
   vakimsdvssvcdrygrq--g--rmvqlraskp                            rq sierdqa--sds-
    rpvsr ilm ttwsrqesp stqa lkktdrn                            ad q ae lnsmavrc
            a rl  egl   llm   vvg pr                            s  d ma f plerha
                    a     a   ga                                e    g  d gedne 
                                                                          e  g  
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
gpaspspg---------e---------g---------------------l--sfpa---i-e-p----------------
---r--q-vmlpcsvte-pqrlfygna-pvstrsprliqmsrvavyrlp-pa----vlp-g-q-pecdkstqtpsppcqa
ktq-rr-rllwdaghqqqqptssshhgmdfal a lfaflressmlsrsrawyytrgterssvsmsa             
nhhyqarlecmedhgspalrlappasp a             g lhtigsssi sqtsdlrpsm l              
aeglsqf       dml g   ci de                  eg  mqlh dfekkeldnl                
 a ddca                                           hg    dd dd g                 
                                                   f          a                 
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------gpwqhraevqiarklqcladqflrlhvqlhqq----------------w------l--
ftsymsafasrsrsimrfwrslaqasqwerq------rrisaelhssgtgq--ptvetastttqrrrnrv-wqillf-hn
 shrplpmttlrqn        qkrnmvsa-rvwserlnyitny----l--pr-imksspwprlmntttssyrvwryyya
 nefldgergakma        neptlsqstsypqvp--mlnkvvwrq-vilakggdpnlqflglfqssgltvspqswwt
 eae       ge         l mgfepqp tlls yqagmhekpgprhhwleefa dg agfi nlld rtcinpiqh
                      e ldddkki pg p vl feg ilemke red             gka k  figfgd
                      d g c h e    a c    a fdaf                           aa   
                        e                    c a                                

       250       260       270     
....:....|....:....|....:....|....:
                                   
--l--------------------------------
ra-nreenrngagprpltwwggrcqtllkgrlmcl
lrqpgrstshqqssmlhssn               
hsfltpqsnpshfe aacng               
anagkgllfgrfed                     
 i e  c a  d                       
   d                               
                                   
© 1998-2020Legal notice