Dataset for protein classical BH3-containing proteins of organism Rhinopithecus bieti

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------p--------legdvfqpsegepqarpgaelsldlfpq-----slldcprs------rlqlf---------lra
msgmfqqmepsrcvee--d-qleredqpdg-qsssstgaqpsaagdrpsdsgkhrlqpspwrvapn-splthccgpg--p
laevaki-sdvssecdrp-rearkatrrvsl-tqrprevgtetdyrprg--e-fh--      l-gglssllplprswd-
   rtwvsraipmptlmyrkng  rsm spgvqlptmdtrrnq lnglrqq-q--qr      -y- imkpfesdv hqg
    rpsrg  lgalkkaevl   npa gl gadgrearecme fl ienm nstml      kkr -cigdam t pee
              gaa  qk   la  ai a a  a  a d     fdmk hqghk      c l aag          
                    a                    a     e ch geddg        h              
                                                  e                             

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
tsqedk-t------s------------e------------r-p-pas---s-p----p-q-----l--vqiarkl-----
p-----s-qtlhpa-psqgvmlpcgvt-epqslfygnagy-l-l---fpa-l-igeq-pegqwqh-aem------qcial
-hmqpqarvssgtgglwfiytrtrswyypasreydefttdkssamrgcdkvtqtpspsc-afnryrsa-avrvvseqlgd
svlverppspyshreilrvteqsshtssvstttmssgpslepnpfmfwssla ptqwea rylhn trlvtnlrgsptrm
qrapqn egcmasq agaqfd rdesrdslgqglf  mee mlie  rrr n gslvar qvgle rlsssiiqdlgkhi
 l aal   af  l  a  e   adll rde fe   d a e     agm   ands    l  a l  leeflagfad 
 e   a                  aif      d                                   kdc    a   
                                                                      a         

       170       180       190       200       210       220  
....:....|....:....|....:....|....:....|....:....|....:....|..
                                                              
--------q----r-r-------------------------r--------------------
qrprlhvq-hqqn-n-vwwwillflhnlalngeenrngagp-rlerpstrpqtslmgrssgl
wfhgvttaptlrrirdtssqtrviftg d yvvwifqyyyaqpttwnnssgssldkaalmcg
plreirshgfpeqmgqskl rgs            yiswwsanapqllhadfq         
l k cki  eetglhcn g f f            paphhd d gkggg c h         
f    af   a d   e                    af                       
                                                              
                                                              
© 1998-2020Legal notice