Dataset for protein classical BH3-containing proteins of organism Rhinopithecus bieti

[Download (right click)] [Edit] [Sequences] [Repertoires]

20 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6KJF1_PMAIP1-      ----------------------MPGKKARKNAQPS---------------
A0A2K6KJM8_BCL2L11      ---MAKQPSDVSSECDREGRQLQPAERPPQLRPGA---------------
A0A2K6KS56_BBC3-02      ---LAERTWS---------------------RGAS---------------
A0A2K6MCW0_BIK-01       MSGVRPVSRDILMETLLYEQLLEPLTMEVLGVTDP---------------
A0A2K6N196_BAD-01       --------------------------------------------------
A0A2K6N196_BAD-02       --------------------------------------------------
A0A2K6KS56_BBC3-01      -------MPRTR-----------------GSSPG---------------P
A0A2K6L919_BMF-01       -------MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCP
A0A2K6L919_BMF-03       -------MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCP
A0A2K6L919_BMF-02       -------MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCP
A0A2K6KJF1_PMAIP1-      ----------------------MPGKKARKNAQPS---------------
A0A2K6KJM8_BCL2L11      ---MAKQPSDVSSECDREGRQLQPAERPPQLRPGA---------------
A0A2K6KJM8_BCL2L11      ---MAKQPSDVSSECDREGRQLQPAERPPQLRPGA---------------
A0A2K6KJM8_BCL2L11      ---MAKQPSDVSSECDREGRQLQPAERPPQLRPGA---------------
A0A2K6KJM8_BCL2L11      ---MAKQPSDVSSECDREGRQLQPAERPPQLRPGA---------------
A0A2K6KJM8_BCL2L11      ---MAKQPSDVSSECDREGRQLQPAERPPQLRPGA---------------
A0A2K6KJM8_BCL2L11      ---MAKQPSDVSSECDREGRQLQPAERPPQLRPGA---------------
A0A2K6KJM8_BCL2L11      ---MAKQPSDVSSECDREGRQLQPAERPPQLRPGA---------------
A0A2K6KJM8_BCL2L11      ---MAKQPSDVSSECDREGRQLQPAERPPQLRPGA---------------
A0A2K6KJM8_BCL2L11      ---MAKQPSDVSSECDREGRQLQPAERPPQLRPGA---------------
                                                                          

A0A2K6KJF1_PMAIP1-      -------PARAQAELEVECAT-----------------------------
A0A2K6KJM8_BCL2L11      -------PTSLQTEPQAS--------------------------------
A0A2K6KS56_BBC3-02      -------PGALAAPGVAG--------------------------------
A0A2K6MCW0_BIK-01       -------EEDLDPMEDFDPLECMEDSDM-LALRLACIGDEMDVSLRAPRL
A0A2K6N196_BAD-01       ----------MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQ
A0A2K6N196_BAD-02       ----------MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQ
A0A2K6KS56_BBC3-01      VEGWPRRPSPLPARPVLRPL------------------------RARPAA
A0A2K6L919_BMF-01       LSRLQLFPLTHCCGPGLRPTS--------------------QEDKATQTL
A0A2K6L919_BMF-03       LSRLQLFPLTHCCGPGLRPTS--------------------QEDKATQTL
A0A2K6L919_BMF-02       LSRLQLFPLTHCCGPGLRPTS--------------------QEDKATQTL
A0A2K6KJF1_PMAIP1-      -------PARAQAGPAGTAGTARDQAGLGIGMQLHFTRGKKLLSSSP---
A0A2K6KJM8_BCL2L11      -------PTSLQTEPQ----------------------------------
A0A2K6KJM8_BCL2L11      -------PTSLQTEPQ----------------------------------
A0A2K6KJM8_BCL2L11      -------PTSLQTEPQGNPED--NHGGEGDSCPHGSPQGPLAPPASPGPF
A0A2K6KJM8_BCL2L11      -------PTSLQTEPQGNPED--NHGGEGDSCPHGSPQGPLAPPASPGPF
A0A2K6KJM8_BCL2L11      -------PTSLQTEPQGNPED--NHGGEGDSCPHGSPQGPLAPPASPGPF
A0A2K6KJM8_BCL2L11      -------PTSLQTEPQGNPED--NHGGEGDSCPHGSPQGPLAPPASPGPF
A0A2K6KJM8_BCL2L11      -------PTSLQTEPQGNPED--NHGGEGDSCPHGSPQGPLAPPASPGPF
A0A2K6KJM8_BCL2L11      -------PTSLQTEPQGNPED--NHGGEGDSCPHGSPQGPLAPPASPGPF
A0A2K6KJM8_BCL2L11      -------PTSLQTEPQGNPED--NHGGEGDSCPHGSPQGPLAPPASPGPF
                                                                          

A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6KS56_BBC3-02      --------------------------------------------------
A0A2K6MCW0_BIK-01       AQLSEVAMHSLGLAFIYDQTDDIRDVLTSFMDGFTTLKENIMRFW-----
A0A2K6N196_BAD-01       AP-----------GLLWDASHQQEQPTSSSHHGGAGAVETRSRHSSYPAG
A0A2K6N196_BAD-02       AP-----------GLLWDASHQQEQPTSSSHHGG--------RAWYYPAE
A0A2K6KS56_BBC3-01      APAAPALLARLPPLRPHRPRRP--APPLGRWPGPAAAPGPRPEVSARPPP
A0A2K6L919_BMF-01       GPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLP--------
A0A2K6L919_BMF-03       GPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLP--------
A0A2K6L919_BMF-02       GPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLP--------
A0A2K6KJF1_PMAIP1-      ---------------LALPRGHEEQVQVARSRVCYSTQEIWR--------
A0A2K6KJM8_BCL2L11      ----------------------------DRSPAPMSCDKSTQ--------
A0A2K6KJM8_BCL2L11      ----------------------------DRSPAPMSCDKSTQ--------
A0A2K6KJM8_BCL2L11      ATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQ--------
A0A2K6KJM8_BCL2L11      ATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQ--------
A0A2K6KJM8_BCL2L11      ATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQ--------
A0A2K6KJM8_BCL2L11      ATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQ--------
A0A2K6KJM8_BCL2L11      ATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQ--------
A0A2K6KJM8_BCL2L11      ATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQ--------
A0A2K6KJM8_BCL2L11      ATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQ--------
                                                                          

A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6KJM8_BCL2L11      -------------------------------------RRQAEPADMRPEI
A0A2K6KS56_BBC3-02      -------------------------------------RRRSGPG------
A0A2K6MCW0_BIK-01       ----------------RSLNPGSQVSREQVLLALLLLLAALLSGGLHLLL
A0A2K6N196_BAD-01       TEEDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLP
A0A2K6N196_BAD-02       SEDSENPSARMLAEASAGMSAPATDSEAQ--------LAENVKLEALGLW
A0A2K6KS56_BBC3-01      GLIGVGRTWSRGASPGALAGGPPGGPGSRGEEAKWAGNRGPAAADGETTQ
A0A2K6L919_BMF-01       -----------------IGEQPPEGQWQHRAEVQIA-RKLQCIADQFHRL
A0A2K6L919_BMF-03       -----------------IGEQPPEGQWQHRAEVQIA-RKLQCIADQFHRL
A0A2K6L919_BMF-02       -----------------IGEQPPEGQWQHRAEVQIA-RKLQCIADQFHRL
A0A2K6KJF1_PMAIP1-      ------------------QTELPAETFESDSQTLLL-RNLTASKTCIRGL
A0A2K6KJM8_BCL2L11      ------------------TPSPPCQAFNHYLSAMVV-ILED---------
A0A2K6KJM8_BCL2L11      ------------------TPSPPCQAFNHYLSAMAS-RRQAEPADMRPEI
A0A2K6KJM8_BCL2L11      ------------------TPSPPCQAFNHYLSAMAS-RRQAEPADMRPEI
A0A2K6KJM8_BCL2L11      ------------------TPSPPCQAFNHYLSAMAS-RRQAEPADMRPEI
A0A2K6KJM8_BCL2L11      ------------------TPSPPCQAFNHYLSAMAS-RRQAEPADMRPEI
A0A2K6KJM8_BCL2L11      ------------------TPSPPCQAFNHYLSAMAS-RRQAEPADMRPEI
A0A2K6KJM8_BCL2L11      ------------------TPSPPCQAFNHYLSAMGI-FE-----------
A0A2K6KJM8_BCL2L11      ------------------TPSPPCQAFNHYLSAMAN-WD-----------
A0A2K6KJM8_BCL2L11      ------------------TPSPPCQAFNHYLSAMVR-EIEEVVV------
                                                                          

A0A2K6KJF1_PMAIP1-      ----QLRRFGDKLNFRQKLLNLIAKLFCSGT-------------------
A0A2K6KJM8_BCL2L11      RIAQELRRIG----------DEFNAYYARRLAKLLASST-----------
A0A2K6KS56_BBC3-02      -IGAQLRRMA----------RRLNAQYRRRRQEEQQRHRPSPWRVLYNLI
A0A2K6MCW0_BIK-01       K-------------------------------------------------
A0A2K6N196_BAD-01       RP--KSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ----------
A0A2K6N196_BAD-02       RPGVATAPTPRGRRRTKGWRRSPAPFGAARAPRPLTSGQHSDMAASSGG-
A0A2K6KS56_BBC3-01      RAVQTAETRGAAATPPLALEGPVQSHYGTPALTQGPQSPRNGAQLGACTR
A0A2K6L919_BMF-01       HVQQHQQNRN-------------RVWWQILLFLHNLALNGEENRNGAGPR
A0A2K6L919_BMF-03       HVQQHQQNRN-------------RVWWQILLFLHNLALNGEENRNGAGPR
A0A2K6L919_BMF-02       HVQQHQQNRN-------------RVWWQILLFLHNLALNGEENRNGAGPR
A0A2K6KJF1_PMAIP1-      QTRIFLRRCT----------FHQFEERLHCNW------------------
A0A2K6KJM8_BCL2L11      -IGDTSLWFG----------FIFTGLDLYVVWIYIYHHSQDTEQLNHRDF
A0A2K6KJM8_BCL2L11      RIAQELRRIG----------DEFNAYYARRVFLNNYQAAEDHPQMVILRL
A0A2K6KJM8_BCL2L11      RIAQELRRIG----------DEFNAYYARRVFLNNYQAAEDHPQMVILRL
A0A2K6KJM8_BCL2L11      RIAQELRRIG----------DEFNAYYARRVFLNNYQAAEDHPQMVILRL
A0A2K6KJM8_BCL2L11      RIAQELRRIG----------DEFNAYYARRLEK-----------------
A0A2K6KJM8_BCL2L11      RIAQELRRIG----------DEFNAYYARRMSLPPD--------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
                                                                          

A0A2K6KJF1_PMAIP1-      ----------------------------
A0A2K6KJM8_BCL2L11      ----------------------------
A0A2K6KS56_BBC3-02      MGLLPLPRGHRAPEMEPN----------
A0A2K6MCW0_BIK-01       ----------------------------
A0A2K6N196_BAD-01       ----------------------------
A0A2K6N196_BAD-02       ----------------------------
A0A2K6KS56_BBC3-01      PVDVRDSGGRPLPPPDTLASAGDFLCTM
A0A2K6L919_BMF-01       ----------------------------
A0A2K6L919_BMF-03       ----------------------------
A0A2K6L919_BMF-02       PLTWNGGRCQTLLKGRLMCL--------
A0A2K6KJF1_PMAIP1-      ----------------------------
A0A2K6KJM8_BCL2L11      S---------------------------
A0A2K6KJM8_BCL2L11      LRYIVRLVWRMH----------------
A0A2K6KJM8_BCL2L11      LRYIVRLVWRMH----------------
A0A2K6KJM8_BCL2L11      LRYIVRLVWRMH----------------
A0A2K6KJM8_BCL2L11      ----------------------------
A0A2K6KJM8_BCL2L11      ----------------------------
A0A2K6KJM8_BCL2L11      ----------------------------
A0A2K6KJM8_BCL2L11      ----------------------------
A0A2K6KJM8_BCL2L11      ----------------------------
                                                    

© 1998-2021Legal notice