Dataset for protein classical BH3-containing proteins of organism Rhinopithecus bieti

[Download (right click)] [Edit] [Sequences] [Repertoires]

20 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6KS56_BBC3-01      --------------------------------------------------
A0A2K6L919_BMF-02       --------------------------------------------------
A0A2K6L919_BMF-03       --------------------------------------------------
A0A2K6L919_BMF-01       --------------------------------------------------
A0A2K6MCW0_BIK-01       MSGVRPVSRDILMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLEC
A0A2K6N196_BAD-02       --------------------------------------MFQIPEFEPSEQ
A0A2K6N196_BAD-01       --------------------------------------MFQIPEFEPSEQ
A0A2K6KS56_BBC3-02      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
                                                                          

A0A2K6KJF1_PMAIP1-      --------------------------MPGKKARKNAQPSPARAQAELEVE
A0A2K6KS56_BBC3-01      ---------MPRTR-----------------GSSPG--------------
A0A2K6L919_BMF-02       ---------MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLD
A0A2K6L919_BMF-03       ---------MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLD
A0A2K6L919_BMF-01       ---------MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLD
A0A2K6MCW0_BIK-01       MEDSDM-LALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTDD
A0A2K6N196_BAD-02       EDSSSAERGLGPSPAGDRPSDSGKHHRQAP-----------GLLWDASHQ
A0A2K6N196_BAD-01       EDSSSAERGLGPSPAGDRPSDSGKHHRQAP-----------GLLWDASHQ
A0A2K6KS56_BBC3-02      LAERTWSRGASPGALAAPGVAGRRRSGPGIGAQLRRMARRLNAQYRRRRQ
A0A2K6KJF1_PMAIP1-      --------------------------MPGKKARKNAQPSPARAQAGPAGT
A0A2K6KJP8_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ--
A0A2K6KJP8_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ--
A0A2K6KJP8_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ--
A0A2K6KJP8_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGN
A0A2K6KJP8_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGN
A0A2K6KJP8_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGN
A0A2K6KJP8_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGN
A0A2K6KJP8_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGN
A0A2K6KJP8_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGN
A0A2K6KJP8_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGN
                                                                          

A0A2K6KJF1_PMAIP1-      CAT-----------------------------------------------
A0A2K6KS56_BBC3-01      -PVEGWPRRPSPLPARPVLRPL----RARPAAAPAAPALLARLPPLRPHR
A0A2K6L919_BMF-02       CPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEE
A0A2K6L919_BMF-03       CPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEE
A0A2K6L919_BMF-01       CPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEE
A0A2K6MCW0_BIK-01       IRDVLTSFMDGFTTLKENIMRFW---------------------RSL---
A0A2K6N196_BAD-02       QEQPTSSSHHGG--------RAWYYPAESEDSENPSARMLAEASAGM---
A0A2K6N196_BAD-01       QEQPTSSSHHGGAGAVETRSRHSSYPAGTEEDEGMEEEPSPFRGRSR---
A0A2K6KS56_BBC3-02      EEQ-----------------------------------------------
A0A2K6KJF1_PMAIP1-      AGTARDQAGLGIGMQLHFTRGKKLLSSSP------------------LAL
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      PED--NHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSR
A0A2K6KJP8_BCL2L11      PED--NHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSR
A0A2K6KJP8_BCL2L11      PED--NHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSR
A0A2K6KJP8_BCL2L11      PED--NHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSR
A0A2K6KJP8_BCL2L11      PED--NHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSR
A0A2K6KJP8_BCL2L11      PED--NHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSR
A0A2K6KJP8_BCL2L11      PED--NHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSR
                                                                          

A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6KS56_BBC3-01      PRRP--APPLGRWPGPAAAPGPRPEVSARPPPGLIGVGRTWSRGASPGAL
A0A2K6L919_BMF-02       PQRLFYGNAGYRLPLPASFPAVLP-------------------------I
A0A2K6L919_BMF-03       PQRLFYGNAGYRLPLPASFPAVLP-------------------------I
A0A2K6L919_BMF-01       PQRLFYGNAGYRLPLPASFPAVLP-------------------------I
A0A2K6MCW0_BIK-01       ----------NPGSQVSREQVLLA--------------------------
A0A2K6N196_BAD-02       ----------SAPATDSEAQ------------------------------
A0A2K6N196_BAD-01       ----------SAPPNLWAAQRYGR--------------------------
A0A2K6KS56_BBC3-02      ---------------------QRH--------------------------
A0A2K6KJF1_PMAIP1-      PRGHEEQVQVARSRVCYSTQEIWR--------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      ----------DRSPAPMSCDKSTQ--------------------------
A0A2K6KJP8_BCL2L11      ----------DRSPAPMSCDKSTQ--------------------------
A0A2K6KJP8_BCL2L11      SSSGYFSFDTDRSPAPMSCDKSTQ--------------------------
A0A2K6KJP8_BCL2L11      SSSGYFSFDTDRSPAPMSCDKSTQ--------------------------
A0A2K6KJP8_BCL2L11      SSSGYFSFDTDRSPAPMSCDKSTQ--------------------------
A0A2K6KJP8_BCL2L11      SSSGYFSFDTDRSPAPMSCDKSTQ--------------------------
A0A2K6KJP8_BCL2L11      SSSGYFSFDTDRSPAPMSCDKSTQ--------------------------
A0A2K6KJP8_BCL2L11      SSSGYFSFDTDRSPAPMSCDKSTQ--------------------------
A0A2K6KJP8_BCL2L11      SSSGYFSFDTDRSPAPMSCDKSTQ--------------------------
                                                                          

A0A2K6KJF1_PMAIP1-      QLRRFGDKLNFRQKLLNLIAKLFCSGT-----------------------
A0A2K6KS56_BBC3-01      AGGPPGGPGSRGEEAKWAGNRGPAAADGETTQRAVQTAETRGAAATPPLA
A0A2K6L919_BMF-02       GEQPPEGQWQHRAEVQIA-RKLQCIADQFHRLHVQQHQQNRN--------
A0A2K6L919_BMF-03       GEQPPEGQWQHRAEVQIA-RKLQCIADQFHRLHVQQHQQNRN--------
A0A2K6L919_BMF-01       GEQPPEGQWQHRAEVQIA-RKLQCIADQFHRLHVQQHQQNRN--------
A0A2K6MCW0_BIK-01       LLLLLAALLSGGLHLLLK--------------------------------
A0A2K6N196_BAD-02       ----LAENVKLEALGLWR-PGVATAPTPRGRRRTKGWRRSPAPFGAARAP
A0A2K6N196_BAD-01       ELRRMSDEFVDSFKGLPR-P--KSAGTATQMRQSSSWTRVFQSWWDRNLG
A0A2K6KS56_BBC3-02      RPSPWRVLYNLIMGLLPL-PRGHRAPEMEPN-------------------
A0A2K6KJF1_PMAIP1-      QTELPAETFESDSQTLLL-RNLTASKTCIRGLQTRIFLRRC--TFHQFEE
A0A2K6KJP8_BCL2L11      ----------------AS-RRQAEPADMRPEIRIAQELRRIGDEFNAYYA
A0A2K6KJP8_BCL2L11      TPSPPCQAFNHYLSAMVV-ILED----------IGDTSLWFGFIFTGLDL
A0A2K6KJP8_BCL2L11      TPSPPCQAFNHYLSAMAS-RRQAEPADMRPEIRIAQELRRIGDEFNAYYA
A0A2K6KJP8_BCL2L11      TPSPPCQAFNHYLSAMVR-EIEEVVV------------------------
A0A2K6KJP8_BCL2L11      TPSPPCQAFNHYLSAMAN-WD-----------------------------
A0A2K6KJP8_BCL2L11      TPSPPCQAFNHYLSAMGI-FE-----------------------------
A0A2K6KJP8_BCL2L11      TPSPPCQAFNHYLSAMAS-RRQAEPADMRPEIRIAQELRRIGDEFNAYYA
A0A2K6KJP8_BCL2L11      TPSPPCQAFNHYLSAMAS-RRQAEPADMRPEIRIAQELRRIGDEFNAYYA
A0A2K6KJP8_BCL2L11      TPSPPCQAFNHYLSAMAS-RRQAEPADMRPEIRIAQELRRIGDEFNAYYA
A0A2K6KJP8_BCL2L11      TPSPPCQAFNHYLSAMAS-RRQAEPADMRPEIRIAQELRRIGDEFNAYYA
                                                                          

A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6KS56_BBC3-01      LEGPVQSHYGTPALTQGPQSPRNGAQLGACTRPVDVRDSGGRPLPPPDTL
A0A2K6L919_BMF-02       -----RVWWQILLFLHNLALNGEENRNGAGPRPLTWNGGRCQTLLKGRLM
A0A2K6L919_BMF-03       -----RVWWQILLFLHNLALNGEENRNGAGPR------------------
A0A2K6L919_BMF-01       -----RVWWQILLFLHNLALNGEENRNGAGPR------------------
A0A2K6MCW0_BIK-01       --------------------------------------------------
A0A2K6N196_BAD-02       RPLTSGQHSDMAASSGG---------------------------------
A0A2K6N196_BAD-01       RGSSAPSQ------------------------------------------
A0A2K6KS56_BBC3-02      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      RLHCNW--------------------------------------------
A0A2K6KJP8_BCL2L11      RRLAKLLASST---------------------------------------
A0A2K6KJP8_BCL2L11      YVVWIYIYHHSQDTEQLNHRDFS---------------------------
A0A2K6KJP8_BCL2L11      RRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH----------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      RRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH----------------
A0A2K6KJP8_BCL2L11      RRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH----------------
A0A2K6KJP8_BCL2L11      RRLEK---------------------------------------------
A0A2K6KJP8_BCL2L11      RRMSLPPD------------------------------------------
                                                                          

A0A2K6KJF1_PMAIP1-      ----------
A0A2K6KS56_BBC3-01      ASAGDFLCTM
A0A2K6L919_BMF-02       CL--------
A0A2K6L919_BMF-03       ----------
A0A2K6L919_BMF-01       ----------
A0A2K6MCW0_BIK-01       ----------
A0A2K6N196_BAD-02       ----------
A0A2K6N196_BAD-01       ----------
A0A2K6KS56_BBC3-02      ----------
A0A2K6KJF1_PMAIP1-      ----------
A0A2K6KJP8_BCL2L11      ----------
A0A2K6KJP8_BCL2L11      ----------
A0A2K6KJP8_BCL2L11      ----------
A0A2K6KJP8_BCL2L11      ----------
A0A2K6KJP8_BCL2L11      ----------
A0A2K6KJP8_BCL2L11      ----------
A0A2K6KJP8_BCL2L11      ----------
A0A2K6KJP8_BCL2L11      ----------
A0A2K6KJP8_BCL2L11      ----------
A0A2K6KJP8_BCL2L11      ----------
                                  

© 1998-2020Legal notice