Dataset for protein classical BH3-containing proteins of organism Rhinopithecus bieti

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6KJP8_BCL2L11      ---MAKQPSDVSSECDREGRQLQPAERPPQLRPGAP--------------
A0A2K6KJF1_PMAIP1-      ---------------------------MPGKKARKN--------------
A0A2K6L919_BMF-02       -------MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCP
A0A2K6L919_BMF-01       -------MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCP
A0A2K6L919_BMF-03       -------MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCP
A0A2K6MCW0_BIK-01       MSGVRPVSRDILMETLLYEQLLEPLTMEVLGVTDPE--------------
A0A2K6KJP8_BCL2L11      ---MAKQPSDVSSECDREGRQLQPAERPPQLRPGAP--------------
A0A2K6N196_BAD-01       ---MFQIP------------EFEPSEQEDS--SSAE--------------
A0A2K6N196_BAD-02       ---MFQIP------------EFEPSEQEDS--SSAE--------------
A0A2K6KJF1_PMAIP1-      ---------------------------MPGKKARKN--------------
A0A2K6KS56_BBC3-02      -----------LAERTWSRGASPGALAAPGVAGRRR--------------
                                                                          

A0A2K6KJP8_BCL2L11      --------------TSLQTEPQDRSP------------------------
A0A2K6KJF1_PMAIP1-      --------------AQPSPARAQAGPAGTAGTARDQAG------------
A0A2K6L919_BMF-02       LSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQ
A0A2K6L919_BMF-01       LSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQ
A0A2K6L919_BMF-03       LSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQ
A0A2K6MCW0_BIK-01       --------------EDLDPMEDFD------------PLECMEDSDMLALR
A0A2K6KJP8_BCL2L11      --------------TSLQTEPQGNPEDNHGGEGDSCP------HGSPQGP
A0A2K6N196_BAD-01       --------------RGLGPSPAGDRPSDSGKHHRQAPGLLWDASHQQEQP
A0A2K6N196_BAD-02       --------------RGLGPSPAGDRPSDSGKHHRQAPGLLWDASHQQEQP
A0A2K6KJF1_PMAIP1-      --------------AQPSPARAQAELEVECATQLRRFG------------
A0A2K6KS56_BBC3-02      --------------SGPGIGAQLRRMARRLNAQYRRRR------------
                                                                          

A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      -------------------------LGIGMQLHFTRGKKLLSSSPLA---
A0A2K6L919_BMF-02       RLFYGNAG-----------------YRLPLPASFPAVLPIGEQPPE----
A0A2K6L919_BMF-01       RLFYGNAG-----------------YRLPLPASFPAVLPIGEQPPE----
A0A2K6L919_BMF-03       RLFYGNAG-----------------YRLPLPASFPAVLPIGEQPPE----
A0A2K6MCW0_BIK-01       LACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTDDIRDVL------
A0A2K6KJP8_BCL2L11      LAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKS
A0A2K6N196_BAD-01       TSSSHHGGA-------------GAVETRSRHSSYPAGTEEDEGM------
A0A2K6N196_BAD-02       TSSSHHGG---------------------RAWYYPAESEDSENP------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6KS56_BBC3-02      --------------------------------------------------
                                                                          

A0A2K6KJP8_BCL2L11      --------------------------------APMSCDKSTQTPSPPCQA
A0A2K6KJF1_PMAIP1-      --------------------------------LPRGHEEQVQVARSRVCY
A0A2K6L919_BMF-02       --------------------------------GQWQHRAEVQIARKLQCI
A0A2K6L919_BMF-01       --------------------------------GQWQHRAEVQIARKLQCI
A0A2K6L919_BMF-03       --------------------------------GQWQHRAEVQIARKLQCI
A0A2K6MCW0_BIK-01       -----------TSFMDGFTTLKENIMRFWRSLNPGSQVSREQVLLALLLL
A0A2K6KJP8_BCL2L11      TQTPSPPCQAFNHYLSAMASRRQA--------EPADMRPEIRIAQELRRI
A0A2K6N196_BAD-01       -----------EEEPSPFRGRSRS--------APPNLWAAQRYGRELRRM
A0A2K6N196_BAD-02       -----------SARMLAEASAGMS--------APATDSEAQ--------L
A0A2K6KJF1_PMAIP1-      --------------------------------DKLNFRQK------LLNL
A0A2K6KS56_BBC3-02      --------------------------------QEEQQRHRPSPWRVLYNL
                                                                          

A0A2K6KJP8_BCL2L11      FNHYLSAMVVILEDIGDTSLWFGFIFTGLDLYVVWIYIYHHSQDTEQLNH
A0A2K6KJF1_PMAIP1-      STQEIWRQTELPAETFESDSQTLLLRNLTASKTCIRGLQTRIFLRRCTFH
A0A2K6L919_BMF-02       ADQFHRLHVQQHQQ-----------NRNRVWWQILLFLHNLALNGEENRN
A0A2K6L919_BMF-01       ADQFHRLHVQQHQQ-----------NRNRVWWQILLFLHNLALNGEENRN
A0A2K6L919_BMF-03       ADQFHRLHVQQHQQ-----------NRNRVWWQILLFLHNLALNGEENRN
A0A2K6MCW0_BIK-01       LAALLSGGLHLLLK------------------------------------
A0A2K6KJP8_BCL2L11      GDEF-------------------------------NAYYARRLEK-----
A0A2K6N196_BAD-01       SDEFVDSFKGLPRP--KSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAP
A0A2K6N196_BAD-02       AENVKLEALGLWRPGVATAPTPRGRRRTKGWRRSPAPFGAARAPRPLTSG
A0A2K6KJF1_PMAIP1-      IAKLFCSGT-----------------------------------------
A0A2K6KS56_BBC3-02      IMGLLPLPRGHRAPEMEPN-------------------------------
                                                                          

A0A2K6KJP8_BCL2L11      RDFS---------------------
A0A2K6KJF1_PMAIP1-      QFEERLHCNW---------------
A0A2K6L919_BMF-02       GAGPRPLTWNGGRCQTLLKGRLMCL
A0A2K6L919_BMF-01       GAGPR--------------------
A0A2K6L919_BMF-03       GAGPR--------------------
A0A2K6MCW0_BIK-01       -------------------------
A0A2K6KJP8_BCL2L11      -------------------------
A0A2K6N196_BAD-01       SQ-----------------------
A0A2K6N196_BAD-02       QHSDMAASSGG--------------
A0A2K6KJF1_PMAIP1-      -------------------------
A0A2K6KS56_BBC3-02      -------------------------
                                                 

© 1998-2020Legal notice