Dataset for protein Puma of organism Rhinopithecus bieti

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80

        90       100       110       120       130       140       150       160
         . *************.  ** .* * . .  ..:    *   ::  *  .  * .   .:*  .* . : .
arpppgligae             agp  ga r geeagiaanlgpa adgeaqq arqqa qqgaaas pla eglimg

       170       180       190       200       210   
    *   ..*:   *                                     
hlgl aghqa emep gaqlgactrpvdvrdsggrplpppdtlasagdflctm
© 1998-2022Legal notice