Dataset for protein Puma of organism Rhinopithecus bieti

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6KS56_BBC3-01      MPRTRGSSPGPVEGWPRRPSPLPARPVLRPLRARPAAAPAAPALLARLPP
A0A2K6KS56_BBC3-02      --------------------------------------------------
                                                                          

A0A2K6KS56_BBC3-01      LRPHRPRRPAPPLGRWPGPAAAPGPRPEVSARPPPGLIGVGRTWSRGASP
A0A2K6KS56_BBC3-02      --------------------------------------LAERTWSRGASP
                                                               . *********

A0A2K6KS56_BBC3-01      GALAGGPPGGPGSRGEEAKWAGNRGPAAADGETTQRAVQTAETRGAAATP
A0A2K6KS56_BBC3-02      GALAA--PGVAGRRRSGPGIGAQLRRMARRLNAQYRRRRQEEQQRHRPSP
                        ****.  ** .* * . .  ..:    *   ::  *  .  * .   .:*

A0A2K6KS56_BBC3-01      PLALEGPVQSHYGTPALTQGPQSPRNGAQLGACTRPVDVRDSGGRPLPPP
A0A2K6KS56_BBC3-02      WRVLYNLIMGLLPLPRGHRAPEMEPN------------------------
                          .* . : .    *   ..*:   *                        

A0A2K6KS56_BBC3-01      DTLASAGDFLCTM
A0A2K6KS56_BBC3-02      -------------
                                     

© 1998-2020Legal notice