Dataset for protein classical BH3-containing proteins of organism Rattus norvegicus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------pgtpkr-slppahv------lglrk---------saprprslg--------r-aaq
msearlmardiiktmphrqvrrpmm--r-qpmsecevagdvspveqqlwmrdqvyrtwddlgi-a--semggrrw-prp-
              llgdkapqnaavs-t-vrka vreecgdarre erigclescnqvvfqlt-vrddaprklspr--t
                      mc-rqgspsngs qpc      pd dqaaak     tsed qqilaqlh ckm lsts
                        vlp qegge  dg       g  af         p    pp     d  a  kmsr
                         kn hdae    f       a   d              fc           g  p
                         ca a       c                          a               m

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
srsq-p---p----dacttgrprgpsltadqpgpylapgllgsivq---g-----s-h----------------------
rmfpl-efe-seqe--seqltglwslaslalslanqtawpwsrrt-qqp-qarnp-h-gssqtgtspttsspssypagvm
-l--istrvmarlkgt--pdsvqaiwvpersqatsfrsstfpwlsttpltwvawnggyrvrprdrrtqrprhalssqsth
p-vts qln hgegerys-tlrp dkrnplgkvqfalrpianpfqrrssllssssqlrpqgge pmedglq   p mqqe
avqce gil dd aalgph gqi  f c iaf la ien  fla lfagahpcpd dpfgfda ka        a   cd
  d   aga      e d   aa  a          cdk   i  fa   gc g                          
               d                      c      a                                  

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
lstgvpsepsrlfggnagyrlplpasfptsaapgvrvseeepprlraevrigrelrrmadefngtytglprrrsqmtqhr
kpsqtteplqqfryr            ylqsmlsiqqprsqwlqhwpaqqyaqq qcis qlhesfk    pkrhgqdyq
eeepme a epaanh             ag  a e peqgafen    ie  ak    g d eaq e      lfenat 
 dc      ca                               ad                             aaae   
                                                                                
                                                                                

       250       260       270   
....:....|....:....|....:....|...
                                 
------------lf-----l-r--g--------
qrrdspwrviyq--ltvlr-v-rl-rpgvtpwq
mnqsrsqtrvlnswrqsipwpwnvpkgwslqs 
haepha mqmi rlpmnflvnslrngeemg n 
e   a     f   mgl ifllhphaa he l 
               fi a f de         
                    d            
© 1998-2020Legal notice