Dataset for protein classical BH3-containing proteins of organism Rattus norvegicus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                          .                                          :          
----------------mgtptqpssppepa------------------eglrk---------ssprirslg------rlr
mlamvtrrgvkarrmapararrgglstahvfnhylsamasirqsqegpldaarilrwayetwdd-gpfpvldelgrk-wm
   feppqcreepgssvlqskdeepa qvg                ecsq spgidkvqcqv-al-ltaidsrrsgty-f
      mp  c lendcfprh trgg cqc                  gl  aeg i aa  t-fdqsr  eqmperqt 
              dc dn e ap    f                   a              l a qq  cpfn lks 
                 ck                                                    adah     

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                            :                                   
paavsc-------p-----------gl-gpgl----qedqaapyllpalyl-iv---p---a------------------
rstqrrfripefe-seqedasttdr--ce-svrpvstlappgqafawrrlgs--tqp-gvt-nnshprwpgghrsrprgp
klmrnmyqsrtrv amlpalrdrwpwi -dka    parrltlw vsgas-capqaqcaqaealgghggrnttytlslsh
  fmcdsppadpl qlvk ecaql r  cai     nvlkklft sgkspsqgtml      epqrlfygflmsrif   
   h  a e  dh  d              a        afiar i   hnl                 a agei     
   a                                       n     fa                             

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
rpdgpqpssspaqqhlespvpsapealaggptqaapgvrveeeewlarrigaqlrrmaddlnaqyeglprprrrqeeqqr
v     haly  gteegeqpeegqspfr rsrs p nl      faqqeyeveia ksqeiegsfk     kshmtqthq
         f   sa d gm  el                       h a r     l cfad  h      lagqah m
                                                                                
                                                                                

       250       260       270  
....:....|....:....|....:....|..
                                
--------------------------------
hrpspwrvmynlfmgllplprdpgapgmepnq
rqsrs trviqswlqn awn rlnrgevt w 
n daa  qif         d ne ke sg s 
                                
                                
© 1998-2022Legal notice