Dataset for protein classical BH3-containing proteins of organism Rattus norvegicus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                       .                        
--------------------------------------------p--pr-p-msparlm---------------------
mararqegsssepvsgrtwespsvpplgrlmpsavscglcepsv-pt--s-sllepaylardiiktllhdqvggprwpgg
        mapa  ealardfarpf   i            ggmmgl kqrgrg  hvccaptappavtaal        
                                           lcfc ahed a   a                      
                                             aa  a a                            

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                     *  .  *                         :..:       
------------pqp-----------pv---------GvedvsPg-rvrdld--r------qvalrlaclgdemdrrlrr
hrsrprgprpdg---avvsgapsmke--psapealag ptqar -v------fm-clesrn-------siasdlngcyws
               slspaqqhles            lrksd  l weeeqwa       vtgaq rrm   ahaqrm 
                                      cg  a  i  aaae         ei    qa     g  ae 
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                       :   ::*                                  
prlvqlpgipmhrpaa--------------tysqtpvrglfrsllGsltnlr----------pga---pdqdpg------
raa------a-qelslqedasttdrgrwpwltrpsgwpyiapwfi rrvq--eniwswrvft---wvs------qlfpmv
  -rsrfql-elleqh         alg srhedqqgavmynl m lislqqd           qaannsmhgnrfltsi
   qpmdp  af   e               caaa   a  ag     pap                  ehe        
                                                                                

       250      
....:....|....:.
                
----------------
llvflllggawhlqlq
iflshvp         
                
                
© 1998-2022Legal notice