Dataset for protein classical BH3-containing proteins of organism Rattus norvegicus

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


O35147_BAD-01          ------------------------MGTPKQPSLAPAHA------LGLRK-
Q8K589_BMF-01          -------------------------------MEPPQCV------EELED-
O88498_BCL2L11-01      -----------------------MAKQPSDVNSECDRE------GGQLQ-
Q80ZG6_BBC3-01         -----------------------MARARQE-GSSPEPV------EGLAR-
Q925D2_BIK-01          MSEARLMARDIIKTLLHDQVPQPAVVSGAPSMKEPVGVEDVSPVRDLDFM
P62817_HRK-01          ----------------------MCPCPRHRGRGPPAVCGCGDARPGLRWA
Q5U777_PMAIP1-01       --------------MPGRKARRNAPLNPTRAELPPEFA------AQLRKI
Q6P7C5_BAD-01          ------------------------MGTPKQPSLAPAHA------LGLRK-
                                                                         

O35147_BAD-01          --------SDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASTTD
Q8K589_BMF-01          --------DVFQP-------------------------------EDGEPG
O88498_BCL2L11-01      --------PAERPPQLR--------PGAPTSLQTESQGNPDGEGDRCPHG
Q80ZG6_BBC3-01         --------DSPRPFPLG--------RLMPSAVSC----------GLCEPG
Q925D2_BIK-01          RCLESRNQVALRLACIGDEMDRCL---RSPRLVQLPGIAMHRLAATYSQT
P62817_HRK-01          AAQV----TALRLQALGDELHRRAMRRRARPRDPLPALLPA--------L
Q5U777_PMAIP1-01       GDKVYCTWSAPDITAVLAQMPGKKSRKSTMRRSPSPTRVPADLKDECDQL
Q6P7C5_BAD-01          --------SDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASTTD
                                                                         

O35147_BAD-01          RGLGPSLTEDQPGPYLAPGLLGSIVQQQPGQAANNSHH--GGAGTMETRS
Q8K589_BMF-01          TQPGSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPVSQEDKATQTL
O88498_BCL2L11-01      SPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSP---
Q80ZG6_BBC3-01         LPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGGHRSRPRGPRPDGP
Q925D2_BIK-01          GVRGIFRSLIGSLTNLRENIWSWRVFTPGAWVSPDQDPGQ----------
P62817_HRK-01          RARWPWLCAAAQVAALAAWLLGRRSA------------------------
Q5U777_PMAIP1-01       RRIGDKVNLRQKLLNFISKLFNLIT-------------------------
Q6P7C5_BAD-01          RGLGPSLTEDQPGPYLAPGLLGSIVQQQPGQAANNSHHGG----------
                                                                         

O35147_BAD-01          RHSSYPAGTEEDEGMEEELSPFRGR----------------------SRS
Q8K589_BMF-01          SPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGSALGEQPPEG
O88498_BCL2L11-01      ----APMSCDKSTQTPSPPCQAFNH------------YLSAMASIRQSQE
Q80ZG6_BBC3-01         QPSLSPAQQHLESPVPSAPEALAGG------------PTQAAPGVRVEEE
Q925D2_BIK-01          --------------------------------------------------
P62817_HRK-01          --------------------------------------------------
Q5U777_PMAIP1-01       --------------------------------------------------
Q6P7C5_BAD-01          --------------------------------------------------
                                                                         

O35147_BAD-01          APPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQSASWTRI
Q8K589_BMF-01          QFLQHRAEVQIARKLQCIADQFH---------RLHMQQHQQNRDRAWRQV
O88498_BCL2L11-01      EPEDLRPEIRIAQELRRIGDEFNETYT----RRAFANDYREAEDHPQMVI
Q80ZG6_BBC3-01         EWAR-----EIGAQLRRMADDLNAQYE----RRRQEEQHRH-RPSPWRVM
Q925D2_BIK-01          --------------------------------------------------
P62817_HRK-01          --------------------------------------------------
Q5U777_PMAIP1-01       --------------------------------------------------
Q6P7C5_BAD-01          --------------------------------------------------
                                                                         

O35147_BAD-01          IQSW-----WDRNLGKGGSTPSQ
Q8K589_BMF-01          F-LFLQNLALNRRENREGVGPW-
O88498_BCL2L11-01      LQLLRFIFRLVWRRH--------
Q80ZG6_BBC3-01         YNLFMGLLPLPRDPGAPEMEPN-
Q925D2_BIK-01          --LFPMVLLVFLLLGGAWHLQLQ
P62817_HRK-01          -----------------------
Q5U777_PMAIP1-01       -----------------------
Q6P7C5_BAD-01          --RFLTSIIFLSHVP--------
                                              

© 1998-2020Legal notice