Dataset for protein classical BH3-containing proteins of organism Rattus norvegicus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q925D2_BIK-01       ----------------------------------------------------MSEARLMA
Q80ZG6_BBC3-01      MARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCGLCEPGLPAAPAAPALLPAAYLC
Q925D2_BIK-02       --------MASAPVSARTWEFASVPPLGIL-----------GSVPFLPRSEDMSEARLMA
P62817_HRK-01       -------------------------------------------MCPCPRHRGRGPPAVC-
Q6P7C5_BAD-01       --------------------------------------------MGTPKQPSLAPAHAL-
                                                                           .    

Q925D2_BIK-01       RDIIKTLLHDQV--------------------PQPAVVSGAPSMKEPV---------GVE
Q80ZG6_BBC3-01      APTAPPAVTAALGGPRWPGGHRSRPRGPRPDGPQPSLSPAQQHLESPVPSAPEALAGGPT
Q925D2_BIK-02       RDIIKTLLHDQV--------------------PQPAVVSGAPSMKEPV---------GVE
P62817_HRK-01       ---------------------------------------------------------GCG
Q6P7C5_BAD-01       ---------------------------------------------------------GLR
                                                                             *  

Q925D2_BIK-01       DVSP---VRDLDFMRCLESRNQVALRLACIGDEMDRCLRSPRLVQLPGIAMHRLAA----
Q80ZG6_BBC3-01      QAAPGVRVEEEEWAR------EIGAQLRRMADDLNAQYERRR---------QEEQH----
Q925D2_BIK-02       DVSP---VRDLDFMRCLESRNQVALRLACIGDEMDRCLRSPRLVQLPGIAMHRLAA----
P62817_HRK-01       DARPGLRWAAAQ---------VTALRLQALGDELHRRAMRRRARPRDPLPALLPAL----
Q6P7C5_BAD-01       KSDPGIR---------------------SLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDA
                    .  *                         :..:                           

Q925D2_BIK-01       ----------TYSQTGVRGIFRSLIGSLTNLRENIWSWRVFTPGAWVSPDQDPGQLFPMV
Q80ZG6_BBC3-01      ----------RHRPSPWRVMYNLFMGLLPLPRD---------PGA---PEMEPN------
Q925D2_BIK-02       ----------TYSQTGVRGIFRSLIGSLTNLRENIWSWRVFTPGAWVSPDQDPGQLFPMV
P62817_HRK-01       ----RARWPWLCAAAQVAALAAWLLGRRSA------------------------------
Q6P7C5_BAD-01       STTDRGLGPSLTEDQPGPYLAPGLLGSIVQQQ----------PGQAANNSHHGGRFLTSI
                                       :   ::*                                  

Q925D2_BIK-01       LLVFLLLGGAWHLQLQ
Q80ZG6_BBC3-01      ----------------
Q925D2_BIK-02       LLVFLLLGGAWHLQLQ
P62817_HRK-01       ----------------
Q6P7C5_BAD-01       IFLSHVP---------
                                    

© 1998-2022Legal notice