Dataset for protein classical BH3-containing proteins of organism Rattus norvegicus

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q8K589_BMF-01          ---MEPPQCVEELEDDVFQPEDGEPGTQPG------------------SL
O35147_BAD-01          ----------------MGTPKQPSLAPAHA------------------LG
Q80ZG6_BBC3-01         ----------------MARARQEGSSPEPV------------------EG
Q80ZG6_BBC3-02         MLAFVTRRGVCAPGSAMARARQEGSSPEPV------------------EG
O88498_BCL2L11-01      --------------MSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPED
P62817_HRK-01          --------------MCPCPRHRGRGPPAVC----------------GCGD
Q5U777_PMAIP1-01       ------MPGRKARRNAPLNPTRAELPPEFA------------------AQ
Q6P7C5_BAD-01          ----------------MGTPKQPSLAPAHA------------------LG
                                                 .                       

Q8K589_BMF-01          LSA---------DLFAQSQLDCPLSRLQLFPLTHCC--------------
O35147_BAD-01          LRK---------SDPGIRSLGERRGRKRWRPAAQSMFQIPEFEPSEQEDA
Q80ZG6_BBC3-01         LAR---------DSPRPFPLG------RLMPSAVSC--------------
Q80ZG6_BBC3-02         LAR---------DSPRPFPLG------RLMPSAVSC--------------
O88498_BCL2L11-01      LRPEIRIAQE------LRRIGDEFNETYTRRAFANDYREAEDHPQMV---
P62817_HRK-01          ARPGLRWAAAQVTALRLQALGDELH----RRAMRRRARPRDPLPALLPAL
Q5U777_PMAIP1-01       LRKIGDKVYCTWSAPDITAVLAQMPGKKSRKSTMRRSPSPTRVPADLKDE
Q6P7C5_BAD-01          LRK---------SDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDA
                                          :                              

Q8K589_BMF-01          --------GPGLRPVSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
O35147_BAD-01          STTDRGL-GPSL----TEDQPGPYLAPGLLGSIVQQQPGQAANNSHHGGA
Q80ZG6_BBC3-01         -----GLCEPGL----PAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWP
Q80ZG6_BBC3-02         -----GLCEPGL----PAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWP
O88498_BCL2L11-01      ----------IL----QLLRFIFRLVWRRH--------------------
P62817_HRK-01          RARWPWL-CAAA----QVAALAAWLLGRRSA-------------------
Q5U777_PMAIP1-01       CDQLRRI-GDKV----NLRQKLLNFISKLFNLIT----------------
Q6P7C5_BAD-01          STTDRGL-GPSL----TEDQPGPYLAPGLLGSIVQQQPGQAANNSHHGGR
                                               :                         

Q8K589_BMF-01          NAGYRLPL--------PASFPAGSALGEQPPEGQ----------------
O35147_BAD-01          GTMETRSR--------HSSYPAGTEEDEGMEEELSPFRGRSRSAPPNL--
Q80ZG6_BBC3-01         GGHRSRPRGPRPDGPQPSLSPAQQHLESPVPSAPEALAGGPTQAAPGVRV
Q80ZG6_BBC3-02         GGHRSRPRGPRPDGPQPSLSPAQQHLESPVPSAPEALAGGPTQAAPGVRV
O88498_BCL2L11-01      --------------------------------------------------
P62817_HRK-01          --------------------------------------------------
Q5U777_PMAIP1-01       --------------------------------------------------
Q6P7C5_BAD-01          FLTSIIFLSHVP--------------------------------------
                                                                         

Q8K589_BMF-01          ----FLQHRAEVQIARKLQCIADQFH-----RLHMQQHQQNRDRAWRQVF
O35147_BAD-01          ----WAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQSASWTRII
Q80ZG6_BBC3-01         EEEEW-AREIGAQLRRMADDLNAQYE-----RRRQEEQHRHRPSPWRVMY
Q80ZG6_BBC3-02         EEEEW-AREIGAQLRRMADDLNAQYE-----RRRQEEQHRHRPSPWRVMY
O88498_BCL2L11-01      --------------------------------------------------
P62817_HRK-01          --------------------------------------------------
Q5U777_PMAIP1-01       --------------------------------------------------
Q6P7C5_BAD-01          --------------------------------------------------
                                                                         

Q8K589_BMF-01          -LFLQNLALNRRENREGVGPW-
O35147_BAD-01          QSW-----WDRNLGKGGSTPSQ
Q80ZG6_BBC3-01         NLFMGLLPLPRDPGAPEMEPN-
Q80ZG6_BBC3-02         NLFMGLLPLPRDPGAPEMEPN-
O88498_BCL2L11-01      ----------------------
P62817_HRK-01          ----------------------
Q5U777_PMAIP1-01       ----------------------
Q6P7C5_BAD-01          ----------------------
                                             

© 1998-2022Legal notice