Dataset for protein classical BH3-containing proteins of organism Pygocentrus nattereri

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                                     .      .                   
                        mmsqy--nsrydv  v-dtqywr dirdieeekkgik  ggppat nnm ccnvsr
                         hnl ldklndcr    ahmftl  dc e  degdad   ae  r fg     sle
                               ede ac                                           

        90       100       110       120       130       140       150       160
     :   .   :     . .       .:                                                 
ttacafskhaghg spmrf e hqrnesmn gd amsg     sqh malsisstspdels vgcrvrlysesqv     
e  a  eg  ed  laedd d  negamlk  a  eed            n cpa                         

       170       180       190       200       210       220       230       240
                   . .             :   ..:*. :.*:*  :    :   .                  
wqdnedglvrhgggagdgrsfrsrsrs---alw-akkr-arq qmms q yqdtwldkrntqlrsspwgm-eeepafmlw
       alaedd  arrd   r cq-  p---kv a i  k  k       ehm q  mq vqqrgqlra         
                  a              a                         dk rg pfgap          
                                                           ag  a a              

       250       260       270     
 lqtssraleq lllspsdngersdlr        
 khli g hdl ggheghagea             
 g a  d   i  ef  e                 
      a      a                     
© 1998-2022Legal notice