Dataset for protein classical BH3-containing proteins of organism Pygocentrus nattereri

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                      .         
-------------------------m------agr-a-l-eqgesgqssgaassraaeqceqpepgegdpv-----mpns
llsarkarfsvcpcsspedrihhlp-snrsnr---p-f-k----------------------ltqskqtvfrggit----
                         hyrsyyqmlhrftfsdesdtsedl d dqpyksvrktmsgegdh l     v er
                          qlqnlckf m r ncde            e kkiae ded             p
                                ca                                              
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.     .         .. *                                                            
llgyqsrsplfrtlsrsssGyfsfesepssplvt-------p------spssqvith---r--e--g-----elwply--
vrwtsywttsmneikqqer tvtpgdqda-----hsastqt-qrrsqy--a-----aalq-ia-vr-naqtf------tv
fmesrq rsaiameald isrmdrpaernwsmtvknvssepldlfhgs-lslss-ssvepshagcrvrqysqsqvep 
 cdn l nh c  d h    aq h  g    nlelpcggde        m gnilptppd le  e amlledelam   
                                g                   l cl                        
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                     . .             :   ..:*. :.*:*         .  .               
------------------nhhpphg---aapagdmrpesyvgqeLrrigDeFnelyfhgvsrlrgcvagmq----pfwfl
srwqdnedgllaedggagdgrsfrsrsrs---alw-akkr-arq qmms q dtwldkqmtqvhs------nlss-----
                  rrd   r cq-  p---kv a i  k  k     yqehml hrnrgnspqlrtmhrqwvsmt
                    a              a                       dk qa rggkqae qn sfls
                                                           ag  a  ap a eg aa r
                                                                         ae     

       250       260     
....:....|....:....|....:
                         
wlsl--r-l-e-e--r---------
--g-vy-s-s-v-svltgrrvrqre
lgwssrtrdlkrsps-sapdtdpa 
iaaalkgl hdqmlrar        
f   hieh f elfg n        
    fa d   a ea e        
© 1998-2022Legal notice