Dataset for protein classical BH3-containing proteins of organism Pygocentrus nattereri

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                           .     .      :    .  
--------------------------------------------------------deqgtsgqssgaawsraakqceqp
msnsyyqrfsvcrfsspeerykkvpkyltsnratrftplcwnslrttacamekhss-dsdevfdqdtsysretverikss
lqsqrlcklrrapcnce d ihhliht rgemghppn                 mlkgisdmevmgeqnqpsssrngdle
 l ankac                       k gm a                 lee e   d l d d    i ea   
                                                      fd                        

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
: .                :                        . * .                               
epgeqdpvrggitp--pnsllgyqsrsplfrtlsr--------sssGylsfesgpsspl---------------------
qsdtgtsm-----masngrfsevvqevr--sesqyytvsrwqdqed lfrlgpeardghvthsmstqtpspsssvittal
 r shplgaspas-   em rcsrc nhsynrdfv        n a avlhdgsvgpedlegaalqed    lq csh  
 l q h   pn r    de p gg  e  m   al        g     aead  a  a                     
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
              :    .  *.               ..:*. :.*:*                      .       
-------------elwpryrshPph------dmwpesyygqqLrrigDeFnt--------------lylhgvsqlrgcva
qriaeargnaqtfsfrrlsnha a-gaapagalr-akkvare qmms q deehmlqhrnqrnqqp-wfrlmktvhtssp
             q amepqrr   sv    ---k ari  k  k     yq              fldkkgdrrysllf
             p  g c               a                                  d a a  aag 
                                                                                

       250       260       270       
....:....|....:....|....:....|....:..
  :  :                               
grqalsnrvwfsqlw--k-------------------
eme--aspsrvdfr-ss-esesresssltapdtrpae
ak pvtagrlhtimgllsghdgea             
   mh   ga    fghr e                 
        d      af                    
© 1998-2020Legal notice