Dataset for protein classical BH3-containing proteins of organism Pygocentrus nattereri

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B4DUY7_BAD-01       MSNQYLQKLRRARFNCEEERYKKVIKTLTGEKGTPFNPLCWNSLRTTACA
A0A3B4CPH6_BAD-01       -------------------------------MAHMFT-------------
A0A3B4CNJ8_BMF-01       --------------------------------------------------
A0A3B4BVX1_BCL2L11      MQNSNYCCF-----------------------------------------
A0A3B4BVX1_BCL2L11      LLSARKARFSVCPCSSPEDRIHHLPHYLRSNRAGRPA-------------
                                                                          

A0A3B4DUY7_BAD-01       MEKHSEDGISTMDDQDESNWSETVKNGDSPQLDSQHSMASNISPASPDEL
A0A3B4CPH6_BAD-01       ----LSDDSDTSEDLGDADQPEASKRAELSQSGQHPLV--------PERF
A0A3B4CNJ8_BMF-01       ----MDEDEDDVFVMDTQYWRSSIREIKQEERGTQTPGRPPARP--NGML
A0A3B4BVX1_BCL2L11      -------EQGESGQSSGAASSRAAEQCEQPEPGEGDPVRGGITM--PNSL
A0A3B4BVX1_BCL2L11      ----FLKEQGESGQSSGAASSRAAEQCEQPEPGEGDPVRGGITM--PNSL
                                 .     .      :    .  : .                :

A0A3B4DUY7_BAD-01       SEVGCRVRLYSESQVYTVSRWQDNEDGLLAEDGGAGDGA-----------
A0A3B4CPH6_BAD-01       RESRQRNHSMNEDAL--------QESGAVRHGDGAADGD-----------
A0A3B4CNJ8_BMF-01       PCGVSEEP--RRLFY--------GSAGLLLLAPSVRPEHVEGAMLQED--
A0A3B4BVX1_BCL2L11      LGYQSRSPLFRTLSR--------SSSGYFSFESEPSSPLLT--------S
A0A3B4BVX1_BCL2L11      LGYQSRSPLFRTLSR--------SSSGYFSFESEPSSPLVTHSASTQTPS
                                                . * .                     

A0A3B4DUY7_BAD-01       -----------------------PFRGRSQSAPA-------ALWKAKKYG
A0A3B4CPH6_BAD-01       -----------------------SFRRRCRSAPP-------ALWAAKKYG
A0A3B4CNJ8_BMF-01       -----------------------QLAMEPRRRPPHSV--------EARIG
A0A3B4BVX1_BCL2L11      PSLSVCST---------------ELWPLYNHHPPHGAAPAGDMRPESYVA
A0A3B4BVX1_BCL2L11      PSSQVITHALQRIAEARGNAQTFELWPLYNHHPPHGAAPAGDMRPESYVA
                                                :    .  *.               .

A0A3B4DUY7_BAD-01       RQLRRMSDEFDT---------------WLDKGDTRRASSPGKQ--TNRGW
A0A3B4CPH6_BAD-01       RQLRKMSDEFDT--------------LLDKGMKRVRSAGAARQMHASPSW
A0A3B4CNJ8_BMF-01       QKLQMIGDQFYQEHMLQHRNQRNQQPFWLRLASALYTLLFEREPVANGRR
A0A3B4BVX1_BCL2L11      QELRRIGDEFNE--------------LYFHGVSQLHGCVAGMQALSARDL
A0A3B4BVX1_BCL2L11      QELRRIGDEFNE--------------LYFHGVSQLHGCVAGMQALSNPVA
                        .:*. :.*:*                      .         :  :    

A0A3B4DUY7_BAD-01       FSFLWGSKEEEGRE-------------
A0A3B4CPH6_BAD-01       FTFLWSHKESDSEASSSLTAPDTRPAE
A0A3B4CNJ8_BMF-01       VDQR-----------------------
A0A3B4BVX1_BCL2L11      HDQMFALS-------------------
A0A3B4BVX1_BCL2L11      FSILGLFRGH-----------------
                                                   

© 1998-2020Legal notice