Dataset for protein classical BH3-containing proteins of organism Pygocentrus nattereri

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B4CPH6_BAD-01       --------------------------------MAHMFTLSDDSDTSEDLG
A0A3B4CNJ8_BMF-01       --------------------------------------------------
A0A3B4BSH7_BCL2L11      LLSARKARFSVCPCSSPEDRIHHLPHYLRSNRAGRPAFLKEQGESGQSSG
A0A3B4BSH7_BCL2L11      -------------------------MQNSNYCCF------EQGESGQSSG
A0A3B4BSH7_BCL2L11      -------------------------MSRRSNRAGRPAFLKEQGESGQSSG
A0A3B4DUY7_BAD-01       -------------------------MSNQYLQKLRRARFNCEEE------
                                                                          

A0A3B4CPH6_BAD-01       DADQPEASKRAELSQSGQHPL-----VPERFRESRQRNHSMNEDALQESG
A0A3B4CNJ8_BMF-01       ------------MDEDEDDVF---------VMDTQYWRSSIREIKQEERG
A0A3B4BSH7_BCL2L11      AASSRAAEQCEQPEPGEGDPVRGGITMPNSLLGYQSRSPLFRTLSRSSSG
A0A3B4BSH7_BCL2L11      AASSRAAEQCEQPEPGEGDPVRGGITMPNSLLGYQSRSPLFRTLSRSSSG
A0A3B4BSH7_BCL2L11      AASSRAAEQCEQPEPGEGDPVRGGITMPNSLLGYQSRSPLFRTLSRSSSG
A0A3B4DUY7_BAD-01       ----RYKKVIKTLTGEKGTPF-------NPLCWNSLRTTACAMEKHSEDG
                                            .         .     .         .. *

A0A3B4CPH6_BAD-01       AVRHGDGAA-----------------------------------------
A0A3B4CNJ8_BMF-01       TQTPGRPPARPNGMLPCGVSEEPRRLFYGSAGLLLLAPSVRPEHVEGAML
A0A3B4BSH7_BCL2L11      YFSFESEPSSPLVTHSASTQTP------SPSSQVITHALQRIAEARGNAQ
A0A3B4BSH7_BCL2L11      YFSFESEPSSPLLT--------------SPSLSVCST-------------
A0A3B4BSH7_BCL2L11      YFSFESEPSSPLVTHSASTQTP------SPSSQVITHALQRIAEARGNAQ
A0A3B4DUY7_BAD-01       ISTMDDQDESNWSETVKNGDSPQLDSQHSMASNISPASPDELSEVGCRVR
                                                                          

A0A3B4CPH6_BAD-01       ----------------------------DGDSFRRRCRSAPPALWAAKKY
A0A3B4CNJ8_BMF-01       QEDQLAMEP-------------------RRRPPHS-----------VEAR
A0A3B4BSH7_BCL2L11      TFELWPLY--------------------NHHPPHG---AAPAGDMRPESY
A0A3B4BSH7_BCL2L11      --ELWPLY--------------------NHHPPHG---AAPAGDMRPESY
A0A3B4BSH7_BCL2L11      TFELWPLY--------------------NHHPPHG---AAPAGDMRPESY
A0A3B4DUY7_BAD-01       LYSESQVYTVSRWQDNEDGLLAEDGGAGDGAPFRGRSQSAPAALWKAKKY
                                                       . .             :  

A0A3B4CPH6_BAD-01       -GRQLRKMSDEFDTLLDKGMKRVRSAGAARQMHASPSWFTFLWSHKESDS
A0A3B4CNJ8_BMF-01       IGQKLQMIGDQFYQEHMLQHRNQRN--------QQPFWLRLASALYTLLF
A0A3B4BSH7_BCL2L11      VAQELRRIGDEFNELYFHGVSQLHGCVAGMQALSNPVAFSILGLFRGH--
A0A3B4BSH7_BCL2L11      VAQELRRIGDEFNELYFHGVSQLHGCVAGMQ-----------ALSARDLH
A0A3B4BSH7_BCL2L11      VAQELRRIGDEFNELYFHGAGRNGGRVQLPAE-EEPAFMLWLGLVIRRLL
A0A3B4DUY7_BAD-01       -GRQLRRMSDEFDTWLDKGDTRRASSPGKQTN-RGWFSFLWGS-------
                         ..:*. :.*:*         .  .                         

A0A3B4CPH6_BAD-01       EASSSLTAPDTRPAE
A0A3B4CNJ8_BMF-01       EREPVANGRRVDQR-
A0A3B4BSH7_BCL2L11      ---------------
A0A3B4BSH7_BCL2L11      DQMFALS--------
A0A3B4BSH7_BCL2L11      EVLLRRR--------
A0A3B4DUY7_BAD-01       KEEEGRE--------
                                       

© 1998-2022Legal notice