Dataset for protein Bim of organism Pygocentrus nattereri

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
: .:. . *                               ****************************************
mqssrycrF-------------------------------EQGESGQSSGAASSRAAEQCEQPEPGEGDPVRGGITMPNS
llnankac svcpcsspedrihhlphylrsnragrpaflk                                        

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************:*        *** .* :                **************
LLGYQSRSPLFRTLSRSSSGYFSFESEPSSPLvT--------SPSssVitt---------------ELWPLYNHHPPHGA
                                l hsastqtp   lq cshalqriaeargnaqtf              

       170       180       190       200       210         
....:....|....:....|....:....|....:....|....:....|....:....
*********************************************    .. :  :   
APAGDMRPESYVAQELRRIGDEFNELYFHGVSQLHGCVAGMQALSnrvlhsqmglls--
                                             apdafdilfafrgh
© 1998-2020Legal notice