Dataset for protein Bim of organism Pygocentrus nattereri

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B4BVX1_BCL2L11      MQNSNYCCF-------------------------------EQGESGQSSG
A0A3B4BVX1_BCL2L11      LLSARKARFSVCPCSSPEDRIHHLPHYLRSNRAGRPAFLKEQGESGQSSG
                        : .:. . *                               **********

A0A3B4BVX1_BCL2L11      AASSRAAEQCEQPEPGEGDPVRGGITMPNSLLGYQSRSPLFRTLSRSSSG
A0A3B4BVX1_BCL2L11      AASSRAAEQCEQPEPGEGDPVRGGITMPNSLLGYQSRSPLFRTLSRSSSG
                        **************************************************

A0A3B4BVX1_BCL2L11      YFSFESEPSSPLLT--------SPSLSVCST---------------ELWP
A0A3B4BVX1_BCL2L11      YFSFESEPSSPLVTHSASTQTPSPSSQVITHALQRIAEARGNAQTFELWP
                        ************:*        *** .* :                ****

A0A3B4BVX1_BCL2L11      LYNHHPPHGAAPAGDMRPESYVAQELRRIGDEFNELYFHGVSQLHGCVAG
A0A3B4BVX1_BCL2L11      LYNHHPPHGAAPAGDMRPESYVAQELRRIGDEFNELYFHGVSQLHGCVAG
                        **************************************************

A0A3B4BVX1_BCL2L11      MQALSARDLHDQMFALS--
A0A3B4BVX1_BCL2L11      MQALSNPVAFSILGLFRGH
                        *****    .. :  :   

© 1998-2020Legal notice