Dataset for protein classical BH3-containing proteins of organism Propithecus coquereli

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------g--p---g---d------------al--l--pps-----p-----
msqvrpvstdllmetfmepshcvpeleedvsqpem-es-sqp-svl-rdlgpsavscgl--ss-era--rlqla-ttlqc
 feipe          pfehmlresqqdvsfsmvdalqgtpvrpecsaegv        qqqqvdc-lqlrpgf lshct
                    lfearilgslpiagreknrdds clplsrsf        pkrgactgrampgqv gayls
                     ad le     e dn  g  g   fe gpe         mgplpps def cdl a sf 
                                  e  a                     cekh gi   c a        
                                                             f   a   a          
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------gp---p--------q--spsspsrgv-----------------------------------
aptappavtaalggpwwvl--qgr-tssrekgg-tl-hglsrqpqmlpspvtsepqrlfygnagyrlppatshslglplg
               r pgeqgln egqedgetdrcclarrqgelh ecg pea ga a       a lpsmfpe meee
                   h rsq s psppapmgsvevkklasw                     y gmaeeda  a  
                         r  hih  adpm th glks                       ag          
                             hd   c   r  ahap                                   
                                      l     n                                   
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----pgptqtrspvrifvrr-arelrsqsrrfa-dl--qyerrrrsestrtqpsp-raw---l--l--l-----------
pspfga-sacapgllgere-w--lsgasldymsd--nr-papmsqearqqhrsp-w---yqyisl-lp-pvghrapemlp
eq a--vfsasa--fwae-qssq-ia---g-lgfnthas---l-cdkqsfrp--qcqvltnv-mgmavrrrngggsaler
    yqrwrskthr---pssytlpc-rra-q-- ksdkyvtm-wlrlvpaswvt sssfnhlplawwsmqllrlenwpsq
    r qlppdqenvalaqlpge tqlm kg h e rfkrllwpkqhkl psqr npmtwyw wschnanqfqe lrnml
    e  ceh    q g peie    cl  e e   fe qk  nel gg  ain gal eri qf  d l aaa ahdgg
    a  a        d k a      i  a        g     i      gc a           a a         a
                  a                    f             a                          

       250       260       270       280       290     
....:....|....:....|....:....|....:....|....:....|....:
                                                       
-------------------------------------------------------
nrrwiaqelrrigdefnayyprrvflnnyqadedhpqmlilrlvryivrvvwrrh
rpnl                                       l e eel v   
pei                                                    
k                                                      
g                                                      
                                                       
                                                       
© 1998-2020Legal notice