Dataset for protein classical BH3-containing proteins of organism Propithecus coquereli

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------makqpsdvgsecdrpggql-------------------qsverp--
msqvrpvstdllmetfpfehllmppsheveslem-fgag-a-ac--qve-tsfswwvlghipgprsadlfaq--l-clga
 feipe               feesiqcdsesmdk----e-r--sg---e---         etqpslstrtsq-pkh  
                      d lel  l iagdvfrarps epptqvssvg            grhgppprtgdsa  
                                  rmln dqe  leesd vpa            e ael eppcql   
                                  ngeg         p   l                    mm kg   
                                   ea              a                    lh      
                                                                         g      
                                                                         d      

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------------pqlrpgaptslqtepq--p-------
rrgpgprrpaplparppgalgrvlrplrarparcprrprpatrclplrphrparlsrgqlf--ahscg-ggn-egsrege
                                                      vh-lrsvlltacgsq-qpstsqegka
                                                      rctahpt g--a--ltlrgspapdas
                                                      f-s-des svv-qqieetdravlprg
                                                      apnh  p prtwh acseap  hhec
                                                       ki   m alcta   pa l  a   
                                                            g  d r       g      
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-d-c-----------p------------------------------------r----mscdkstq---------------
g-r-shgspqgplap-aspgpfgatrsplfifvrrssllsrsssgyfsfdtd-spap--------gaaetppltlegpvq
tqllrpaylsqgvml cvtagp grsw ggprspprgvteepqrrfyalaeyllqstawrprgas               
satvpa ragprtlr qr  al  p h   rlglgg pavltrqlspgpgdqkrercvvsaalsp               
prwtlv d ca     p              g     grqggpdpll n gphh q stvvphrw               
egsade   a                           a pd aa gk a  g   l lrfs epr               
a i                                                e     ep r dll               
                                                          h   a                 
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----tpsppc-a---y--------------------------lrr-gd-fna---rr-----------------------
shhg------q-fnh-lsamasmrqfqaepadmrpeiwiaqe---i--e---yyp--rrlqqyqssqtwvrpwrvlilll
    lgaqtqgsqgvrgeelqaatrlvcvapwlwgvrrygdq asms flctqreyvlqepnsrrrpsqichpqmwynvi
    yrgmapeplwthwawvvwrievsvlqdvflrtqpppat g ta d hnmqkllvpvnkqphded   rswwqtrrf
    r tl mhgptqerpqspregksrsig qrgarlnl r    l  k efsf kgnfresvlatrp   qmss eq  
    a eg eadespde pegica gifd  ng  a  c l       g adl  h mlkwrrgqpgn    apa     
         a    ma    cf   eada  l                       e ahicllfgna             
              l                                           a aeha i              
                                                              d                 

       330        
....:....|....:...
                  
------------------
lrllvllvgrrhpemepn
mgyiprprwhggshpsqr
qswwd nllgnanglllk
 ln a  gee rlaag  
 h                
                  
                  
                  
© 1998-2022Legal notice