Dataset for protein classical BH3-containing proteins of organism Propithecus coquereli

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------makqpsdvg----secdre-------------
mkfgagsaracpcqmsrvrqvwwvllpvtgpepshcvpeplgdlsqpe-g---tqp-rgsp------vpgtsfswwvlgh
              vpqtspsstspgmipfmrerlpretleevvfsarr-eggmpsaa parvlscd             
               fgipfegsd ehee lfrhglprsiqdrsvpsgdspsl-kf     plpaap             
               aea e           a d ge leg q pimdveln r--     caepss             
                                   fd f      g anccc lrr     a    q             
                                                     dh                         
                                                     ce                         
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------ggqlqsverppqlrpgaptslqtepq-----------------------p-g---------sh-s
ipetrgaaetppltl--aqgqadcalsrlqarslt-g---ggvtrqlqgpwwvrgprsrrrhrr-e-sregegdrc--g-
               lf--sllcatraqt-lf--rh-cpl-asmaafgaerppmph pap gpnitspqdsltqtlrpae
               evpvrrrstgdrn-g--ys-tpagstlc      cpall         shp qepkaslaeqtlw
               s rgppprscakmvaptqpqrcrqiss        l dg         h h gpllwltssplsr
               p  amhhpk  efa dslkpqrqaapr                       g  agavespq  p 
               a   ka li  ca   pchcd d  he                       d     c r p    
                      kg         faa    e                                       
                      h                                                         
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
p--p-appa--g---------p----------------l-r-s-----------------------papmscdkstqtps
-qg-l----sp-eepqptqaa-fatrsplfifvrrgsl-s-s-sgyfsfdtdrsqidrrrqqiadqerrrweeqrgrrq-
spvgvmlgcgvtgragrlfyrsgvrgpeewwarpispqsrtmpdelqwrnraqyaaagklpc    fpvlqvsrqrhswv
ysqmtsssllla   s gvggnaspqevrqasqeadap psqagdfgpqhnrev            vltvrrrtlqaptt
lap sehditae   a fr  lsryplngpsvhvy rg gglgcav  e sgpk            thliplqlhpsnrn
  a r eae m           rgdkg  grhf g le  eg a g  a lfka            ree hkgeglgkll
                      qea     g                                   qca diade daii
                       c                                          g   aa aa   eh
                                                                  c            g
                                                                               a

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
ppcqafnhylsamasmr--qae----------------------------------------------------------
---vlltlvmpll-lp-qf---padprpeiwiaqelrrigdefnayyprrvflnsyqadedhpqmlilrllryivrlvwr
rwrd-y--i-g-fp--alvrgpempmnkrrnlctr vdv  lggrtl ppmt pntgdffctm                 
fqp-twlt-y-w-ltrtghvvgssellgqlga                  dp a d                        
cmwws-gstwqswcannegpsvqhwsqa                                                    
 astqierfqlrrwvllvenrnl ldg                                                     
  qseeaq iknhvrki tiflg g                                                       
  lp   p ghh rdgg lg ia                                                         
  ak   a adf g ec  a                                                            
   g           a                                                                

  
..
  
--
rh
  
  
  
  
  
  
  
  
© 1998-2022Legal notice