Dataset for protein classical BH3-containing proteins of organism Propithecus coquereli

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6FFN3_BMF-02       ---------------MEPSHCVEELEDDVFQPEDGESGTQPGSVLSADLF
A0A2K6FQZ1_BBC3-04      ------------------------------------------MKFGAGSA
A0A2K6FFN3_BMF-01       ---------------MEPSHCVEELEDDVFQPEDGESGTQPGSVLSADLF
A0A2K6FQZ1_BBC3-01      MARARQ---------------EGSSPEPVEGLARDGPRPFPLGRLVPSAV
A0A2K6GE31_BCL2L11      ----------------------------------MAKQPSDVGSECDRE-
A0A2K6GE31_BCL2L11      ----------------------------------MAKQPSDVGSECDRE-
A0A2K6FM79_BIK-01       MSEVRPVSTDLLMETFPFEHLLDPLILEVLSIMDNEENPDPSGCLEDSD-
A0A2K6GWV0_BAD-01       MFQIPE---------------FEPSEQEDSSSAGRGLGPSPSG---DRP-
A0A2K6EM90_PMAIP1-      -------------------------------------MPVKKARKNAQPS
A0A2K6GL98_HRK-01       ----------------------------------MCPCPLHRGRGPPAVC
                                                                          

A0A2K6FFN3_BMF-02       AQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPS------
A0A2K6FQZ1_BBC3-04      RACPCQVPGTSFSWWVLGHIPGPQPSLSLAEQHLE---SPVPSA------
A0A2K6FFN3_BMF-01       AQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLP
A0A2K6FQZ1_BBC3-01      SCGLCEPGLPAA-------PAAPALLPAAYLCAPTAPPAVTAALGGPRWP
A0A2K6GE31_BCL2L11      -----GGQLQSV-------ERPPQLRPGAPTSLQTEPQGNPEGSREGEGD
A0A2K6GE31_BCL2L11      -----GGQLQSV-------ERPPQLRPGAPTSLQTEPQGNPEGSREGEGD
A0A2K6FM79_BIK-01       -----EVALRLA-------CIGDEM-------------------------
A0A2K6GWV0_BAD-01       -----SGPGKHP-------CTAPSFLGDA-----SHQQGQPSSSSHHGGA
A0A2K6EM90_PMAIP1-      PTRT-----RAE--------------------------------------
A0A2K6GL98_HRK-01       ACSAGRLGLRSS--------------------------------------
                                                                          

A0A2K6FFN3_BMF-02       ------------------------------------QGVM------LPCG
A0A2K6FQZ1_BBC3-04      ------------------------------------PGALAGGPTQAAPG
A0A2K6FFN3_BMF-01       CGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPAEGQWQHRAEVQI--
A0A2K6FQZ1_BBC3-01      GGPRSRPRGPRPDGP---QPSLSLAEQHLESPVPSAPGALAGGPTQAAPG
A0A2K6GE31_BCL2L11      RCSHGSPQGPL-------APPAS-------------PGPFATRSPLFI--
A0A2K6GE31_BCL2L11      RCSHGSPQGPL-------APPAS-------------PGPFATRSPLFI--
A0A2K6FM79_BIK-01       DLCLRSPRLAW-------LPGMTMHSLGLA---------LSCDQPVRW--
A0A2K6GWV0_BAD-01       GSVETRSRHSS-------YPAGTEEDEGMEEEPSPFRGRSRSAPPNLW--
A0A2K6EM90_PMAIP1-      --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
                                                                          

A0A2K6FFN3_BMF-02       VTEEPQRLFYAPAEPKSHVVADPPLPTQPCFERRREQERGRSQ-------
A0A2K6FQZ1_BBC3-04      VRGEEEQWAREIGAQLRRMADD----LNAQYERRRQEEQQRHRPSPWRVL
A0A2K6FFN3_BMF-01       ------------ARKLQCIADQFH-----------RLHVQQHQQNQNRMW
A0A2K6FQZ1_BBC3-01      VRGEEEQWAREIGAQLRRMAD----DLNAQYERRRQEEQQRHRPSPWRVL
A0A2K6GE31_BCL2L11      -------FVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAF
A0A2K6GE31_BCL2L11      -------FVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAF
A0A2K6FM79_BIK-01       -------GV------LGSLSDGFA-NLREYVARLWRSLSPRPWVCPAPAW
A0A2K6GWV0_BAD-01       -------AAQRYGRELRRMSDEFE-DSFKKGLPRPKSAGTATQIRQSSSW
A0A2K6EM90_PMAIP1-      -------IEEECALQLRRLGDKLH--FQQKLLNLIAKLFRSGT-------
A0A2K6GL98_HRK-01       -------AAQLTAARLKALGDELH---QRTMWRRRARSRRAPAPGALTTY
                                                                          

A0A2K6FFN3_BMF-02       --------------------------------------------------
A0A2K6FQZ1_BBC3-04      YNLIMGLLPLPRGHRAPEMEPN----------------------------
A0A2K6FFN3_BMF-01       WQILLFLHNLALNGEENRNGAGPR--------------------------
A0A2K6FQZ1_BBC3-01      YNLIMGLLPLPRGHRAPEMEPN----------------------------
A0A2K6GE31_BCL2L11      NHYLSAM-------------------------------------------
A0A2K6GE31_BCL2L11      NHYLSAMASMRQFQAEPADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNY
A0A2K6FM79_BIK-01       EQVLLLLLVLLLLGGGLHLLLK----------------------------
A0A2K6GWV0_BAD-01       TRVIQSWWDRNVGRGGSAPSQ-----------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
A0A2K6GL98_HRK-01       WPWLCAAAQVAALAAWLLGRRNL---------------------------
                                                                          

A0A2K6FFN3_BMF-02       --------------------------
A0A2K6FQZ1_BBC3-04      --------------------------
A0A2K6FFN3_BMF-01       --------------------------
A0A2K6FQZ1_BBC3-01      --------------------------
A0A2K6GE31_BCL2L11      --------------VREIEEVVV---
A0A2K6GE31_BCL2L11      QADEDHPQMLILRLLRYIVRLVWRRH
A0A2K6FM79_BIK-01       --------------------------
A0A2K6GWV0_BAD-01       --------------------------
A0A2K6EM90_PMAIP1-      --------------------------
A0A2K6GL98_HRK-01       --------------------------
                                                  

© 1998-2020Legal notice