Dataset for protein classical BH3-containing proteins of organism Propithecus coquereli

[Download (right click)] [Edit] [Sequences] [Repertoires]

16 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6EM90_PMAIP1-      --------------------------------------------------
A0A2K6FQZ1_BBC3-03      --------------------------------------------------
A0A2K6GE22_BCL2L11      ------------------------------------------------MA
A0A2K6GL98_HRK-01       ------------------------------------------------MC
A0A2K6FQZ1_BBC3-02      MKFGAGSARACPCQVPGTSFSWWVLGHIPGPRERHGPRTPGGQLPGARRG
A0A2K6FFN3_BMF-02       ------------------------------MEPSHCVEELEDDVFQPEDG
A0A2K6FFN3_BMF-01       ------------------------------MEPSHCVEELEDDVFQPEDG
A0A2K6FQZ1_BBC3-04      --------------------------------------------------
A0A2K6FQZ1_BBC3-01      --------------MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVS
A0A2K6GE22_BCL2L11      ------------------------------------------------MA
A0A2K6GE22_BCL2L11      ------------------------------------------------MA
A0A2K6GE22_BCL2L11      ------------------------------------------------MA
A0A2K6GE22_BCL2L11      ------------------------------------------------MA
A0A2K6GE22_BCL2L11      ------------------------------------------------MA
A0A2K6FM79_BIK-01       --------------MSEVRPVSTDLLMETFPFEHLLDPLILEVLSIMDNE
A0A2K6GWV0_BAD-01       --------------MFQIPE---------------FEPSEQEDSSSAGRG
                                                                          

A0A2K6EM90_PMAIP1-      -------------------------------------------------M
A0A2K6FQZ1_BBC3-03      ---MKFGAGSARACPCQVPGTSFSWWVLGHIPETRGAAETPPLTLEGPVQ
A0A2K6GE22_BCL2L11      KQPSDVG----SECDRE----------------------------GGQLQ
A0A2K6GL98_HRK-01       PCPLHRGRGPPAVCACS----------------------------AGRLG
A0A2K6FQZ1_BBC3-02      PGPRRPA----PLPARP----------------------------PGALG
A0A2K6FFN3_BMF-02       ESGTQPG----SVLSAD----------------------------LFAQS
A0A2K6FFN3_BMF-01       ESGTQPG----SVLSAD----------------------------LFAQS
A0A2K6FQZ1_BBC3-04      ---MKFG-----------------------------------------AG
A0A2K6FQZ1_BBC3-01      CGLCEPG-----------------------------------------LP
A0A2K6GE22_BCL2L11      KQPSDVG----SECDRE----------------------------GGQLQ
A0A2K6GE22_BCL2L11      KQPSDVG----SECDRE----------------------------GGQLQ
A0A2K6GE22_BCL2L11      KQPSDVG----SECDRE----------------------------GGQLQ
A0A2K6GE22_BCL2L11      KQPSDVG----SECDRE----------------------------GGQLQ
A0A2K6GE22_BCL2L11      KQPSDVG----SECDRE----------------------------GGQLQ
A0A2K6FM79_BIK-01       ENPDPSG----CLEDSD----------------------------EVALR
A0A2K6GWV0_BAD-01       LGPSPSG-------DRP----------------------------SGPGK
                                                                          

A0A2K6EM90_PMAIP1-      PVKKARKNAQPSPTRTRAEIEE----------------------------
A0A2K6FQZ1_BBC3-03      SHHGTPALTQGPQSPDGAQLGAC---------------------------
A0A2K6GE22_BCL2L11      SVERPPQLRPGAPTSLQTEPQASMRQFQAEPADM----------------
A0A2K6GL98_HRK-01       LRSSAAQLTAARLKALGDELH-----------------------------
A0A2K6FQZ1_BBC3-02      RVLRPLRARPARCPRRPRPATR-------CLPLRPHRPARRHRRPGGPPL
A0A2K6FFN3_BMF-02       QLDCPLSRLQLFPLTHCCGPGL---------------------RPTSQED
A0A2K6FFN3_BMF-01       QLDCPLSRLQLFPLTHCCGPGL---------------------RPTSQED
A0A2K6FQZ1_BBC3-04      SARACPCQVPGTSFS---------------WWVLG--------HIPGPQP
A0A2K6FQZ1_BBC3-01      AAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQP
A0A2K6GE22_BCL2L11      SVERPPQLRPGAPTSLQTEPQ-----------------------------
A0A2K6GE22_BCL2L11      SVERPPQLRPGAPTSLQTEPQG---------------------NPEGSRE
A0A2K6GE22_BCL2L11      SVERPPQLRPGAPTSLQTEPQG---------------------NPEGSRE
A0A2K6GE22_BCL2L11      SVERPPQLRPGAPTSLQTEPQG---------------------NPEGSRE
A0A2K6GE22_BCL2L11      SVERPPQLRPGAPTSLQTEPQG---------------------NPEGSRE
A0A2K6FM79_BIK-01       LACIGDEM-----------------------------------------D
A0A2K6GWV0_BAD-01       HPCTAPSFLGDASHQQGQPSSS---------------------SHHGGAG
                                                                          

A0A2K6EM90_PMAIP1-      --------------------------------------------------
A0A2K6FQZ1_BBC3-03      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
A0A2K6FQZ1_BBC3-02      AWGSPQPTPRPAPGRSSAITLAGRAAPGVARPQRPGGPGGRSHPGGPGSP
A0A2K6FFN3_BMF-02       KATQTLSPASPSQGVMLPCGVTEEPQRLFYAPAEPK----SHVVADPPLP
A0A2K6FFN3_BMF-01       KATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLG
A0A2K6FQZ1_BBC3-04      SLSLAEQHLESPVPSAPGALAG---GPTQAAPGVRGEEEQWAREIGAQLR
A0A2K6FQZ1_BBC3-01      SLSLAEQHLESPVPSAPGALAG---GPTQAAPGVRGEEEQWAREIGAQLR
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      GEGDRCSHGSPQGPLAPPASPG---------PFATRSPLFIFVRRSSLLS
A0A2K6GE22_BCL2L11      GEGDRCSHGSPQGPLAPPASPG---------PFATRSPLFIFVRRSSLLS
A0A2K6GE22_BCL2L11      GEGDRCSHGSPQGPLAPPASPG---------PFATRSPLFIFVRRSSLLS
A0A2K6GE22_BCL2L11      GEGDRCSHGSPQGPLAPPASPG---------PFATRSPLFIFVRRSSLLS
A0A2K6FM79_BIK-01       LCLRSPRLAWLPGMTMHSLGLA---------LSCDQPVRWGV------LG
A0A2K6GWV0_BAD-01       SVETRSRHSSYPAGTEEDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELR
                                                                          

A0A2K6EM90_PMAIP1-      --------------------------ECALQLRRLGDKLHFQQKLLNLIA
A0A2K6FQZ1_BBC3-03      --------------------------TRLVDVGDLGGRTLPPPDTLASTG
A0A2K6GE22_BCL2L11      --------------------------RPEIWIAQELRRIG---DEFNAYY
A0A2K6GL98_HRK-01       --------------------------QRTMWRRRARSRRAPAPGALTTYW
A0A2K6FQZ1_BBC3-02      GGGGAVGPRDRGPAAADGRRPQ----CAVRAAETRGAAETPPLTLEGPVQ
A0A2K6FFN3_BMF-02       TQPC----------------------FERRREQERGRSQ-----------
A0A2K6FFN3_BMF-01       EQPAEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNQNRMWWQILLFL
A0A2K6FQZ1_BBC3-04      RMADDL----NAQY------------ERRRQEEQQRHRPSPWRVLYNLIM
A0A2K6FQZ1_BBC3-01      RMADDL----NAQY------------ERRRQEEQQRHRPSPWRVLYNLIM
A0A2K6GE22_BCL2L11      -----------DRS------------PAPMSCDKSTQTPSPPCQAFNHYL
A0A2K6GE22_BCL2L11      RSSSGYFSFDTDRS------------PAPMSCDKSTQTPSPPCQAFNHYL
A0A2K6GE22_BCL2L11      RSSSGYFSFDTDRS------------PAPMSCDKSTQTPSPPCQAFNHYL
A0A2K6GE22_BCL2L11      RSSSGYFSFDTDRS------------PAPMSCDKSTQTPSPPCQAFNHYL
A0A2K6GE22_BCL2L11      RSSSGYFSFDTDRS------------PAPMSCDKSTQTPSPPCQAFNHYL
A0A2K6FM79_BIK-01       SLSDGF--ANLREY------------VARLWRSLSPRPWVCPAPAWEQVL
A0A2K6GWV0_BAD-01       RMSDEF--EDSFKK------------GLPRPKSAGTATQIRQSSSWTRVI
                                                                          

A0A2K6EM90_PMAIP1-      KLFRSGT-------------------------------------------
A0A2K6FQZ1_BBC3-03      DFFCTM--------------------------------------------
A0A2K6GE22_BCL2L11      PRRLAKCLVPSI--------------------------------------
A0A2K6GL98_HRK-01       PWLCAAAQVAALAAWLLGRRNL----------------------------
A0A2K6FQZ1_BBC3-02      SHHGTPALTQGPQSPDGAQLGACTRLVDVGDLGGRTLPPPDTLASTGDFF
A0A2K6FFN3_BMF-02       --------------------------------------------------
A0A2K6FFN3_BMF-01       HNLALNGEENRNGAGPR---------------------------------
A0A2K6FQZ1_BBC3-04      GLLPLPRGHRAPEMEPN---------------------------------
A0A2K6FQZ1_BBC3-01      GLLPLPRGHRAPEMEPN---------------------------------
A0A2K6GE22_BCL2L11      SAMASMRQFQAEPADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQADE
A0A2K6GE22_BCL2L11      SAMASMRQFQAEPADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQADE
A0A2K6GE22_BCL2L11      SAMASMRQFQAEPADMRPEIWIAQELRRIGDEFNAYYPRRMPLPSD----
A0A2K6GE22_BCL2L11      SAM-----GIFE--------------------------------------
A0A2K6GE22_BCL2L11      SAMVREIEEVVV--------------------------------------
A0A2K6FM79_BIK-01       LLLLVLLLLGGGLHLLLK--------------------------------
A0A2K6GWV0_BAD-01       QSWWDRNVGRGGSAPSQ---------------------------------
                                                                          

A0A2K6EM90_PMAIP1-      ----------------------
A0A2K6FQZ1_BBC3-03      ----------------------
A0A2K6GE22_BCL2L11      ----------------------
A0A2K6GL98_HRK-01       ----------------------
A0A2K6FQZ1_BBC3-02      CTM-------------------
A0A2K6FFN3_BMF-02       ----------------------
A0A2K6FFN3_BMF-01       ----------------------
A0A2K6FQZ1_BBC3-04      ----------------------
A0A2K6FQZ1_BBC3-01      ----------------------
A0A2K6GE22_BCL2L11      DHPQMLILRLLRYIVRLVWRRH
A0A2K6GE22_BCL2L11      DHPQMLILRLLRYIVRLVWRRH
A0A2K6GE22_BCL2L11      ----------------------
A0A2K6GE22_BCL2L11      ----------------------
A0A2K6GE22_BCL2L11      ----------------------
A0A2K6FM79_BIK-01       ----------------------
A0A2K6GWV0_BAD-01       ----------------------
                                              

© 1998-2022Legal notice