Dataset for protein classical BH3-containing proteins of organism Propithecus coquereli

[Download (right click)] [Edit] [Sequences] [Repertoires]

16 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6EM90_PMAIP1-      --------------------------------------------------
A0A2K6FQZ1_BBC3-02      ---------------------------------MKFGAGSARACPCQVPG
A0A2K6FQZ1_BBC3-03      ---------------------------------MKFGAGSARACPCQVPG
A0A2K6FQZ1_BBC3-01      -----------------------------------MARARQEGSSPEPVE
A0A2K6FM79_BIK-01       MSEVRPVSTDLLMETFPFEHLLDPLILEVLSIMDNEENPDPSGCLEDSDE
A0A2K6GWV0_BAD-01       MFQIPE---------------FEPSEQEDSSSAGRGLGPSPSG---DRPS
A0A2K6GL98_HRK-01       --------------------------------------------------
A0A2K6FFN3_BMF-02       ----------------------MEPSHCVEELEDDVFQPED-GESGTQPG
A0A2K6FFN3_BMF-01       ----------------------MEPSHCVEELEDDVFQPED-GESGTQPG
A0A2K6FQZ1_BBC3-04      ---------------------------------MKFGAGSARACPCQVPG
A0A2K6GE22_BCL2L11      ----------------------------------MAKQPSDVGSECDREG
A0A2K6GE22_BCL2L11      ----------------------------------MAKQPSDVGSECDREG
A0A2K6GE22_BCL2L11      ----------------------------------MAKQPSDVGSECDREG
A0A2K6GE22_BCL2L11      ----------------------------------MAKQPSDVGSECDREG
A0A2K6GE22_BCL2L11      ----------------------------------MAKQPSDVGSECDREG
A0A2K6GE22_BCL2L11      ----------------------------------MAKQPSDVGSECDREG
                                                                          

A0A2K6EM90_PMAIP1-      ----------------------MPVKKA----------------------
A0A2K6FQZ1_BBC3-02      TSFSWWVLGHIPGPRERHGPRTPGGQLPGARRGPGPRRPAPLPARPPGAL
A0A2K6FQZ1_BBC3-03      TSFSWWVLGHIPETRGAAETPPLTLEGP----------------------
A0A2K6FQZ1_BBC3-01      GLA-------------------RDGPRP----------------------
A0A2K6FM79_BIK-01       VAL-----------------------RL----------------------
A0A2K6GWV0_BAD-01       GPG-----------------------KH----------------------
A0A2K6GL98_HRK-01       -----------------------MCPCP----------------------
A0A2K6FFN3_BMF-02       SVL------------SADLFAQSQLDCP----------------------
A0A2K6FFN3_BMF-01       SVL------------SADLFAQSQLDCP----------------------
A0A2K6FQZ1_BBC3-04      TSFSWWVLGHIPGPQPSLSLAEQHLESP----------------------
A0A2K6GE22_BCL2L11      GQL-------------------QSVERP----------------------
A0A2K6GE22_BCL2L11      GQL-------------------QSVERP----------------------
A0A2K6GE22_BCL2L11      GQL-------------------QSVERP----------------------
A0A2K6GE22_BCL2L11      GQL-------------------QSVERP----------------------
A0A2K6GE22_BCL2L11      GQL-------------------QSVERP----------------------
A0A2K6GE22_BCL2L11      GQL-------------------QSVERP----------------------
                                                                          

A0A2K6EM90_PMAIP1-      ----------------------------------RKNAQPSPTRTRAEIE
A0A2K6FQZ1_BBC3-02      GRVLRPLRARPARCPRRPRPATRCLPLRPHRPARRHRRPGGPPLAWGSPQ
A0A2K6FQZ1_BBC3-03      ----------------------------------VQSHHGTP-ALTQGPQ
A0A2K6FQZ1_BBC3-01      ----------------------------------FPLGRLVPSAVSCGLC
A0A2K6FM79_BIK-01       ----------------------------------ACIGDEM---------
A0A2K6GWV0_BAD-01       ----------------------------------PCTAPSFLGDASHQQG
A0A2K6GL98_HRK-01       ----------------------------------LHRGRGPPAVCACSAG
A0A2K6FFN3_BMF-02       ----------------------------------LSRLQLFPLTHCCGPG
A0A2K6FFN3_BMF-01       ----------------------------------LSRLQLFPLTHCCGPG
A0A2K6FQZ1_BBC3-04      ----------------------------------V---PSAPGALAGGPT
A0A2K6GE22_BCL2L11      ----------------------------------PQLRPGAPTSLQTEPQ
A0A2K6GE22_BCL2L11      ----------------------------------PQLRPGAPTSLQTEPQ
A0A2K6GE22_BCL2L11      ----------------------------------PQLRPGAPTSLQTEPQ
A0A2K6GE22_BCL2L11      ----------------------------------PQLRPGAPTSLQTEPQ
A0A2K6GE22_BCL2L11      ----------------------------------PQLRPGAPTSLQTEPQ
A0A2K6GE22_BCL2L11      ----------------------------------PQLRPGAPTSLQTEPQ
                                                                          

A0A2K6EM90_PMAIP1-      EE------------------------------------------------
A0A2K6FQZ1_BBC3-02      PTPRPAPGRSSAITLAGRAAPGVARPQRPGGPGGRSHPGGPGSPGGGGAV
A0A2K6FQZ1_BBC3-03      SPDGAQLGACTRLVDVGDLGGRTLPPP-----------------------
A0A2K6FQZ1_BBC3-01      EPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRP
A0A2K6FM79_BIK-01       -----------DLC------------------------------------
A0A2K6GWV0_BAD-01       QPSSSSHHGGAGSV------------------------------------
A0A2K6GL98_HRK-01       ----------------------------------------RLGLRSSAAQ
A0A2K6FFN3_BMF-02       LRPTSQEDKATQTLSPASPSQGVMLPC-------------------GVTE
A0A2K6FFN3_BMF-01       LRPTSQEDKATQTLSPASPSQGVMLPC-------------------GVTE
A0A2K6FQZ1_BBC3-04      QAAPGVRGEEEQWARE----------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      GNPEGSREGEGDRCSHGSPQGPLAPPASPGPF-ATRSPLFIFVRRSSLLS
A0A2K6GE22_BCL2L11      GNPEGSREGEGDRCSHGSPQGPLAPPASPGPF-ATRSPLFIFVRRSSLLS
A0A2K6GE22_BCL2L11      GNPEGSREGEGDRCSHGSPQGPLAPPASPGPF-ATRSPLFIFVRRSSLLS
A0A2K6GE22_BCL2L11      GNPEGSREGEGDRCSHGSPQGPLAPPASPGPF-ATRSPLFIFVRRSSLLS
                                                                          

A0A2K6EM90_PMAIP1-      --------------------------------------------------
A0A2K6FQZ1_BBC3-02      GPRDRGPAAADGRRPQCAVRAAETRGAAETPPLTLEGPVQSHHGTPALTQ
A0A2K6FQZ1_BBC3-03      --------------------------------------------------
A0A2K6FQZ1_BBC3-01      DGPQPSLSLAEQHLESPVPSAPGAL-------------------AGGPTQ
A0A2K6FM79_BIK-01       -----------------LRSPRLAW-------------------LPGMTM
A0A2K6GWV0_BAD-01       -----------------ETRSRHSS-------------------YPAGTE
A0A2K6GL98_HRK-01       LTAARLKALGDELHQRTMWRRRARS-------------------RRAPAP
A0A2K6FFN3_BMF-02       EPQRLFYAPAEPK----SHVVADPP-------------------LPTQPC
A0A2K6FFN3_BMF-01       EPQRLFYGNAGYRLPLPASFPAGLP-------------------LGEQPA
A0A2K6FQZ1_BBC3-04      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      -----------DRSPAPMSCDKSTQ-------------------TPSPPC
A0A2K6GE22_BCL2L11      RSSSGYFSFDTDRSPAPMSCDKSTQ-------------------TPSPPC
A0A2K6GE22_BCL2L11      RSSSGYFSFDTDRSPAPMSCDKSTQ-------------------TPSPPC
A0A2K6GE22_BCL2L11      RSSSGYFSFDTDRSPAPMSCDKSTQ-------------------TPSPPC
A0A2K6GE22_BCL2L11      RSSSGYFSFDTDRSPAPMSCDKSTQ-------------------TPSPPC
                                                                          

A0A2K6EM90_PMAIP1-      ----------------------------CALQLRRLGDKLHFQQKLLNLI
A0A2K6FQZ1_BBC3-02      GPQSPDGAQLGACTRLVDVGDLGGRTLPPPDTLASTGDFFCTM-------
A0A2K6FQZ1_BBC3-03      ------------------------------DTLASTGDFFCTM-------
A0A2K6FQZ1_BBC3-01      AAPGVRGEEEQWARE-------------IGAQLRRMADDLNAQYERRRQE
A0A2K6FM79_BIK-01       HSLGLA---------LSCDQPVRWGV------LGSLSDGFANLREYVARL
A0A2K6GWV0_BAD-01       EDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEDSFKKGLPR
A0A2K6GL98_HRK-01       GALTTYWPWLCAAAQVAALAAWLLGRRNL---------------------
A0A2K6FFN3_BMF-02       ----------------------F----------------------ERRRE
A0A2K6FFN3_BMF-01       EGQWQHRAEVQIARKLQCIADQF----------------------HRLHV
A0A2K6FQZ1_BBC3-04      ----------------------------IGAQLRRMADDLNAQYERRRQE
A0A2K6GE22_BCL2L11      ----------ASMRQFQAEPADMRPEIWIAQELRRIGDEFNAYYPRRLAK
A0A2K6GE22_BCL2L11      QAFNHYLSAMASMRQFQAEPADMRPEIWIAQELRRIGDEFNAYYPRRVFL
A0A2K6GE22_BCL2L11      QAFNHYLSAM-----GIFE-------------------------------
A0A2K6GE22_BCL2L11      QAFNHYLSAMVREIEEVVV-------------------------------
A0A2K6GE22_BCL2L11      QAFNHYLSAMASMRQFQAEPADMRPEIWIAQELRRIGDEFNAYYPRRMPL
A0A2K6GE22_BCL2L11      QAFNHYLSAMASMRQFQAEPADMRPEIWIAQELRRIGDEFNAYYPRRVFL
                                                                          

A0A2K6EM90_PMAIP1-      AKLFRSGT------------------------------
A0A2K6FQZ1_BBC3-02      --------------------------------------
A0A2K6FQZ1_BBC3-03      --------------------------------------
A0A2K6FQZ1_BBC3-01      EQQRHRPS---PWRVLYNLIMGLLPLPRGHRAPEMEPN
A0A2K6FM79_BIK-01       WRSLSPRPWVCPAPAWEQVLLLLLVLLLLGGGLHLLLK
A0A2K6GWV0_BAD-01       PKSAGTATQIRQSSSWTRVIQSWWDRNVGRGGSAPSQ-
A0A2K6GL98_HRK-01       --------------------------------------
A0A2K6FFN3_BMF-02       QERGRSQ-------------------------------
A0A2K6FFN3_BMF-01       QQHQQNQN---RMWWQILLFLHNLALNGEENRNGAGPR
A0A2K6FQZ1_BBC3-04      EQQRHRPS---PWRVLYNLIMGLLPLPRGHRAPEMEPN
A0A2K6GE22_BCL2L11      CLVPSI--------------------------------
A0A2K6GE22_BCL2L11      NNYQADED---HPQMLILRLLRYIVRLVWRRH------
A0A2K6GE22_BCL2L11      --------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------
A0A2K6GE22_BCL2L11      PSD-----------------------------------
A0A2K6GE22_BCL2L11      NNYQADED---HPQMLILRLLRYIVRLVWRRH------
                                                              

© 1998-2022Legal notice