Dataset for protein classical BH3-containing proteins of organism Propithecus coquereli

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6FFN3_BMF-02       ----------------MEPSHCVEELEDDVFQPEDGESGTQPGSVLSADL
A0A2K6FQZ1_BBC3-04      --------------------------------------------------
A0A2K6FQZ1_BBC3-01      --------------------MARARQEGSSPEPVEGLARDGPRPFPLGRL
A0A2K6FFN3_BMF-01       ----------------MEPSHCVEELEDDVFQPEDGESGTQPGSVLSADL
A0A2K6GE31_BCL2L11      ----------------------------------MAKQPSDVGSECDREG
A0A2K6GE31_BCL2L11      ----------------------------------MAKQPSDVGSECDREG
A0A2K6FM79_BIK-01       MSEVRPVSTDLLMETFPFEHLLDPLILEVLSIMDNEENPDPSGCLEDSDE
A0A2K6GWV0_BAD-01       MFQIPE---------------FEPSEQEDSSSAGRGLGPSPSG---DRPS
A0A2K6EM90_PMAIP1-      --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
                                                                          

A0A2K6FFN3_BMF-02       F--------AQSQLDCPLSRLQLFPLTHCC-------------------G
A0A2K6FQZ1_BBC3-04      ---------MKFGAGSARACPCQVPGTSFS---------------WWVLG
A0A2K6FQZ1_BBC3-01      VPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG
A0A2K6FFN3_BMF-01       F--------AQSQLDCPLSRLQLFPLTHCC-------------------G
A0A2K6GE31_BCL2L11      G--------QLQSVERPPQLRPGAPTSLQT-------------------E
A0A2K6GE31_BCL2L11      G--------QLQSVERPPQLRPGAPTSLQT-------------------E
A0A2K6FM79_BIK-01       V--------ALRLACIGDEM------------------------------
A0A2K6GWV0_BAD-01       G--------PGKHPCTAPSFLGDA-----S-------------------H
A0A2K6EM90_PMAIP1-      --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
                                                                          

A0A2K6FFN3_BMF-02       PGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLF-----------
A0A2K6FQZ1_BBC3-04      --------HIPGPQ---PSLSLAEQHLESPVPSAPGALA-----------
A0A2K6FQZ1_BBC3-01      PRSRPRGPRPDGPQ---PSLSLAEQHLESPVPSAPGALA-----------
A0A2K6FFN3_BMF-01       PGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLP
A0A2K6GE31_BCL2L11      PQGNPEGSREGEGDRCSHGSPQGPL---------------------APPA
A0A2K6GE31_BCL2L11      PQGNPEGSREGEGDRCSHGSPQGPL---------------------APPA
A0A2K6FM79_BIK-01       --------------DLCLRSPRLAW---------------------LPGM
A0A2K6GWV0_BAD-01       QQGQPSSSSHHGGAGSVETRSRHSS---------------------YPAG
A0A2K6EM90_PMAIP1-      ----------------MPVKKARKN-------------------------
A0A2K6GL98_HRK-01       -------------MCPCPLHRGRGP-------------------------
                                                                          

A0A2K6FFN3_BMF-02       --------------YAPAEPKSHVVADPPLPTQPC--------------F
A0A2K6FQZ1_BBC3-04      --------------GGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQY
A0A2K6FQZ1_BBC3-01      --------------GGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQY
A0A2K6FFN3_BMF-01       ASFPAGLPLGEQPAEGQWQHRAEVQIARK-----LQCIADQFH-------
A0A2K6GE31_BCL2L11      S-------------PGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSP
A0A2K6GE31_BCL2L11      S-------------PGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSP
A0A2K6FM79_BIK-01       TMHSLGLA---------LSCDQPVRWGV------LGSLSDGFA-NLREYV
A0A2K6GWV0_BAD-01       TEEDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFE-DSFKKG
A0A2K6EM90_PMAIP1-      --------------AQPSPTRT-----RAEIEEECALQLRRLGDKLHFQQ
A0A2K6GL98_HRK-01       --------------PAVCACSAGRLGLRSSAAQLTAARLKALGDELH-QR
                                                                          

A0A2K6FFN3_BMF-02       ERRREQERGRSQ--------------------------------------
A0A2K6FQZ1_BBC3-04      ERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN---------
A0A2K6FQZ1_BBC3-01      ERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN---------
A0A2K6FFN3_BMF-01       ----RLHVQQHQQNQNRMWWQILLFLHNLALNGEENRNGAGPR-------
A0A2K6GE31_BCL2L11      APMSCDKSTQTPSPPCQAFNHYLSAM------------------------
A0A2K6GE31_BCL2L11      APMSCDKSTQTPSPPCQAFNHYLSAMASMRQFQAEPADMRPEIWIAQELR
A0A2K6FM79_BIK-01       ARLWRSLSPRPWVCPAPAWEQVLLLLLVLLLLGGGLHLLLK---------
A0A2K6GWV0_BAD-01       LPRPKSAGTATQIRQSSSWTRVIQSWWDRNVGRGGSAPSQ----------
A0A2K6EM90_PMAIP1-      KLLNLIAKLFRSGT------------------------------------
A0A2K6GL98_HRK-01       TMWRRRARSRRAPAPGALTTYWPWLCAAAQVAALAAWLLGRRNL------
                                                                          

A0A2K6FFN3_BMF-02       ---------------------------------------------
A0A2K6FQZ1_BBC3-04      ---------------------------------------------
A0A2K6FQZ1_BBC3-01      ---------------------------------------------
A0A2K6FFN3_BMF-01       ---------------------------------------------
A0A2K6GE31_BCL2L11      ---------------------------------VREIEEVVV---
A0A2K6GE31_BCL2L11      RIGDEFNAYYPRRVFLNNYQADEDHPQMLILRLLRYIVRLVWRRH
A0A2K6FM79_BIK-01       ---------------------------------------------
A0A2K6GWV0_BAD-01       ---------------------------------------------
A0A2K6EM90_PMAIP1-      ---------------------------------------------
A0A2K6GL98_HRK-01       ---------------------------------------------
                                                                     

© 1998-2020Legal notice