Dataset for protein Bim of organism Propithecus coquereli

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MAKQPSDVGSECDREGGQLQSVERPPQLRPGAPTSLQTEPQGNPEGSREGEGDRCSHGSPQGPLAPPASPGPFATRSPLF
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
***************************************************                             
IFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM-----------------------------
                                                   asmrqfqaepadmrpeiwiaqelrrigde

       170       180       190       200
....:....|....:....|....:....|....:....|
                            :* *  :*    
----------------------------vRyIvrvVw---
fnayyprrvflnnyqadedhpqmlilrll e eel vrrh
© 1998-2020Legal notice