Dataset for protein Bim of organism Propithecus coquereli

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6GE31_BCL2L11      MAKQPSDVGSECDREGGQLQSVERPPQLRPGAPTSLQTEPQGNPEGSREG
A0A2K6GE31_BCL2L11      MAKQPSDVGSECDREGGQLQSVERPPQLRPGAPTSLQTEPQGNPEGSREG
                        **************************************************

A0A2K6GE31_BCL2L11      EGDRCSHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD
A0A2K6GE31_BCL2L11      EGDRCSHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD
                        **************************************************

A0A2K6GE31_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM-------------------
A0A2K6GE31_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQFQAEPADMRPEIWI
                        *******************************                   

A0A2K6GE31_BCL2L11      --------------------------------------VREIEEVVV---
A0A2K6GE31_BCL2L11      AQELRRIGDEFNAYYPRRVFLNNYQADEDHPQMLILRLLRYIVRLVWRRH
                                                              :* *  :*    

© 1998-2020Legal notice