Dataset for protein Puma of organism Propithecus coquereli

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
mkfgagsaracpcqvpgtsfswwvlghip---------------------------------------------------
-----------------------------mprerqgpstpgpvlplarrgpgprrpfplprrvpsavsrvlrplrarpar
                             ga a hegrs egqegg  d       a  galp g lgcg          

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
cprrprpatrclplrphrparrhrrpggpplawgspqptprpapgrssaiylcgrtapgvarpqvtggpggrswpggprs
           e gl aa                          allp at aapa       arpaal  prh    g 

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                ... :.* :*  **.*:  *. .  :      ****   :  ::.   
------------------gpqpslslaeqhtrspvptpPltLe-GPvQshpGvrgltqqwqspiGAQLrrmtrlvnvqyl
pggggavgprprgparpd-----------elegaaesa ga ag  t aah tpaeeegpared    gacaddldagde
          d    aa  rr qcavraa                                                   

       250       260       270       280
....:....|....:....|....:....|....:....|
  *        .*.  .: .:                   
rrRtlpqqrtrpStwrvlytm-------------------
gg qeeppdhla pgdffcnlimgllplprghrapemepn
                                        
© 1998-2022Legal notice