Dataset for protein Puma of organism Propithecus coquereli

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                        : *  :* *.*. :*.: :.               .*  *
---------------------------------------mkfGagsArAcPcqvPgtsfs---------------wWvlG
mararqegsspepveglardgprpfplgrlvpsavscglcep lpa p a all aaylcaptappavtaalggpr pg 
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
hip-----h--gpqpslslaeqhlespvpsapgalaggp----pgvrgeeeqwareigaqlrrmaddlnaqyerrrqeeq
---rprgr-pp----------------------------tqaa-------------------------------------
prsg  eprid  rtpggqlpgarrg g rr ap par       al rvlrpl arp rcp rprpatrclpl phrpa

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
qrh-----------------rpspwrvlynlimgll--------------------------------------------
---rrpggpplawgspqptp----------------apgvarpqrpggpggrshpggpgspggggavgprdrgpaaadgr
r                     a g ssaitla ra                                            

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                        *:   * :* :  .                                          
------------------------PvqshHrtPemtqn------------------------------------------
rpqcavraaetrgaaetppltleg lprg ga alepgpqspdgaqlgactrlvdvgdlggrtlpppdtlastgdffctm
                                                                                
© 1998-2022Legal notice