Dataset for protein Puma of organism Propithecus coquereli

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6FQZ1_BBC3-03      MKFGAGSARACPCQVPGTSFSWWVLGHIP---------------------
A0A2K6FQZ1_BBC3-04      MKFGAGSARACPCQVPGTSFSWWVLGHIP---------------------
A0A2K6FQZ1_BBC3-01      -----------------------------MARARQEGSSPEPVEGLARDG
A0A2K6FQZ1_BBC3-02      MKFGAGSARACPCQVPGTSFSWWVLGHIPGPRERHGPRTPGGQLPGARRG
                                                                          

A0A2K6FQZ1_BBC3-03      --------------------------------------------------
A0A2K6FQZ1_BBC3-04      --------------------------------------------------
A0A2K6FQZ1_BBC3-01      P---RPFPLGRLVPSAVSCGL-------------------CEPGLPAAPA
A0A2K6FQZ1_BBC3-02      PGPRRPAPLPARPPGALGRVLRPLRARPARCPRRPRPATRCLPLRPHRPA
                                                                          

A0A2K6FQZ1_BBC3-03      --------------------------------------------------
A0A2K6FQZ1_BBC3-04      --------------------------------------------------
A0A2K6FQZ1_BBC3-01      ----------------------APALLPAAYLCAPTAP----PAVTAALG
A0A2K6FQZ1_BBC3-02      RRHRRPGGPPLAWGSPQPTPRPAPGRSSAITLAGRAAPGVARPQRPGGPG
                                                                          

A0A2K6FQZ1_BBC3-03      ---------------------------------------ETRGAAETPPL
A0A2K6FQZ1_BBC3-04      ----------------------------GPQPSLSLAEQHLESPVPSAPG
A0A2K6FQZ1_BBC3-01      GPRWPGGPRS---------RPRGP-RPDGPQPSLSLAEQHLESPVPSAPG
A0A2K6FQZ1_BBC3-02      GRSHPGGPGSPGGGGAVGPRDRGPAAADGRRPQCAVRAAETRGAAETPPL
                                                                  ... :.* 

A0A2K6FQZ1_BBC3-03      TLE-GPVQSHHGTPALTQGPQSPDGAQLGACTRLVDVGDLGGRTLPPPDT
A0A2K6FQZ1_BBC3-04      ALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRH
A0A2K6FQZ1_BBC3-01      ALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRH
A0A2K6FQZ1_BBC3-02      TLE-GPVQSHHGTPALTQGPQSPDGAQLGACTRLVDVGDLGGRTLPPPDT
                        :*  **.*:  *. .  :      ****   :  ::.     *       

A0A2K6FQZ1_BBC3-03      LASTGDFFCTM-------------------
A0A2K6FQZ1_BBC3-04      RPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
A0A2K6FQZ1_BBC3-01      RPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
A0A2K6FQZ1_BBC3-02      LASTGDFFCTM-------------------
                         .*.  .: .:                   

© 1998-2022Legal notice