Dataset for protein Puma of organism Propithecus coquereli

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6FQZ1_BBC3-03      ---------------------------------------MKFGAGSARAC
A0A2K6FQZ1_BBC3-02      ---------------------------------------MKFGAGSARAC
A0A2K6FQZ1_BBC3-04      ---------------------------------------MKFGAGSARAC
A0A2K6FQZ1_BBC3-01      MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLPAAPAA
                                                                : *  :* *.

A0A2K6FQZ1_BBC3-03      PCQVPGTSFS---------------WWVLGHIP-----------------
A0A2K6FQZ1_BBC3-02      PCQVPGTSFS---------------WWVLGHIPGPRERH--GPRTPGGQL
A0A2K6FQZ1_BBC3-04      PCQVPGTSFS---------------WWVLG--------HIPGPQPSLSLA
A0A2K6FQZ1_BBC3-01      PALLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSLA
                        *. :*.: :.               .*  *                    

A0A2K6FQZ1_BBC3-03      --------------------------------------------------
A0A2K6FQZ1_BBC3-02      PGARRGPGPRRPAPLPARP----PGALGRVLRPLRARPARCPRRPRPATR
A0A2K6FQZ1_BBC3-04      EQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNA
A0A2K6FQZ1_BBC3-01      EQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNA
                                                                          

A0A2K6FQZ1_BBC3-03      --------------------------------------------------
A0A2K6FQZ1_BBC3-02      CLPLRPHRPARRHRRPGGPPLAWGSPQPTPRPAPGRSSAITLAGRAAPGV
A0A2K6FQZ1_BBC3-04      QYERRRQEEQQRH-----------------RPSPWRVLYNLIMGLL----
A0A2K6FQZ1_BBC3-01      QYERRRQEEQQRH-----------------RPSPWRVLYNLIMGLL----
                                                                          

A0A2K6FQZ1_BBC3-03      -------------------------------------------------E
A0A2K6FQZ1_BBC3-02      ARPQRPGGPGGRSHPGGPGSPGGGGAVGPRDRGPAAADGRRPQCAVRAAE
A0A2K6FQZ1_BBC3-04      --------------------------------------------------
A0A2K6FQZ1_BBC3-01      --------------------------------------------------
                                                                          

A0A2K6FQZ1_BBC3-03      TRGAAETPPLTLEGPVQSHHGTPALTQGPQSPDGAQLGACTRLVDVGDLG
A0A2K6FQZ1_BBC3-02      TRGAAETPPLTLEGPVQSHHGTPALTQGPQSPDGAQLGACTRLVDVGDLG
A0A2K6FQZ1_BBC3-04      --------------PLPRGHRAPEMEPN----------------------
A0A2K6FQZ1_BBC3-01      --------------PLPRGHRAPEMEPN----------------------
                                      *:   * :* :  .                      

A0A2K6FQZ1_BBC3-03      GRTLPPPDTLASTGDFFCTM
A0A2K6FQZ1_BBC3-02      GRTLPPPDTLASTGDFFCTM
A0A2K6FQZ1_BBC3-04      --------------------
A0A2K6FQZ1_BBC3-01      --------------------
                                            

© 1998-2022Legal notice