Dataset for protein Puma of organism Prolemur simus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                        : *  :* *.* :  *::                .** **
---------------------------------------mkpGlpsArAcPhvppAsy----------------sRW-PG
mararqegsspepveglardgprpfplgrlvpsavscglcef aga p a allg aflcaptappavtaalggp  v  

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  *         ********************************************************************
hpR---------GPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEE
gi srprgprpd                                                                    

       170       180       190    
....:....|....:....|....:....|....
**********************************
QQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
                                  
© 1998-2022Legal notice