Dataset for protein Puma of organism Prolemur simus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C9AIW5_BBC3-02      MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLPAAPAA
A0A8C9AIW5_BBC3-01      ---------------------------------------MKFGAGSARAC
                                                                : *  :* *.

A0A8C9AIW5_BBC3-02      PALLPAAYLCAPTAPPAVTAALGGPRW-PGGPRSRPRGPRPDGPQPSLSL
A0A8C9AIW5_BBC3-01      PHVPGASF----------------SRWVPGHIR---------GPQPSLSL
                        * :  *::                .** **  *         ********

A0A8C9AIW5_BBC3-02      AEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLN
A0A8C9AIW5_BBC3-01      AEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLN
                        **************************************************

A0A8C9AIW5_BBC3-02      AQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
A0A8C9AIW5_BBC3-01      AQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
                        ********************************************

© 1998-2022Legal notice