Dataset for protein classical BH3-containing proteins of organism Pongo abelii

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------k-g--smfqipefepsgqsds--------------------------s---glrpspagdrp
mgtpenpspapthaqdvr-r-sq-aqpcecqvvreseatwvscqlfgqslldpprtrsqllpmts-aer--gcacsppqm
    msevrpisrpsqpmqflmgqvlap trrdlavttvllpadicaprerhgmlsflpqfclerrgppwv-rtsqegkl
           medimmvtlayknlces lma gtppga        eed  c edagg e gahcdglptplqqlafgi
               lcgek red     dh  a ag                           g cagara dii aea
                 e e ed      ag                                            c    
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
sgslkhhrqapgllrdashqqeqptssshhgg--r---rsrrssyppstedde--geepspgrgrsrs------------
gltssaasrtq-vssapgalsrgraq-y--aragavvi---hpgwwal--aa-qmas--a-llwvelalaggaapgvara
tvr rsvqlssr-rpsvrvtrprqrmw-rr-esr-pevyhytewlt-gwp--pgv--sl-wf-lsrnt            
pqq gptlpplprplprlprplplelrvqqtapisrtrpgtqttgst-llsvmttwpriqt-s-qnil            
dma afqhgkklamkglamhlh h fqrlpl dh dpl  fllqfrqwkgpslrssaqape qsahag            
     ep  eaa   ec deeg   eicgn     agc  eedp a tfcnidppe n na m  a e            
                    a    af di       a  a  i    e gea f  l                      
                                                a        d                      

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------apqrawaaqlyarelrrmsle-----------------q-q-r
qrpggsggrshpggpgsprgggtvgpgdrgpaaadgg-vpnlmrllr-gq-ah-l-d-fvgsfksglprpksagt-t-m-
                                     r-l-----d-t-gy--n-t-qlldpwrkhvgt attqgpqsrn
                                     qs-trvlg-sqs-qfelvqvhae lvq  ha   l p arrq 
                                     eqmscrkdaenrsheaarpka                  hgp 
                                      gkl p   clkdg   plf                   feh 
                                        i l    i  f   cke                     e 
                                               e  a    h                        

       250       260       270        
....:....|....:....|....:....|....:...
                                      
--s-w---------------------------------
qs-s-trvfqswwdrnlgrrssrpsqtprsassglctm
ttrvlgvsyrpvmvlrsrggpnanphslpn gdfg   
rpkq wqltnllhnvlpnppglsgqemema        
lncp raiplfigg dal eeipagdgaa         
dhah   cla fda a     h   a            
 g g                                  
                                      
© 1998-2022Legal notice