Dataset for protein classical BH3-containing proteins of organism Pongo abelii

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


H2NIS8_HRK-01          ------------------------MCPCPLHRDRGPPAV-----------
H2NZD3_BBC3-01         -----------------MKFGMGSAQACPCQVPRASSATWVPCQICGPRE
H2NWG2_PMAIP1-01       ---------------MPGKKARKNAQPSPARAPAGAGTA-----------
H2NZD3_BBC3-02         -----------------MKFGMGSAQACPCQVPRASSAT-----------
H2P4N6_BIK-01          ----MSEVRPISRDILMETLLYEQLLEPPTMEVLGVTDS--------EED
A0A2J8T301_BMF-01      -----------MEPSQCVEELEDDVFQPEDGEPGTQSGSLLSADLFAQSL
A0A2J8TYJ3_BAD-01      MGTPENPSPAPTHAQDVRQRGSQSMFQIPEFEPSEQEDS-----------
A0A2J8TYJ3_BAD-02      MGTPENPSPAPTHAQDVRQRGSQSMFQIPEFEPSEQEDS-----------
A0A2J8TYJ3_BAD-03      ------------------------MFQIPEFEPSEQEDS-----------
                                                                         

H2NIS8_HRK-01          ----------------------CACSAGRLGLRSSAAQLTAARLKALGDE
H2NZD3_BBC3-01         RHGPRTAGGQLPGARRGPGPRRPAPLPARPPGALGSVLRPLRARPGRRPR
H2NWG2_PMAIP1-01       -------------------GTARDQAGFGIGMQLRFTRGKKLLSSSPLAL
H2NZD3_BBC3-02         -------------------WVPCQICGPQPSLSLAEQHLESPVPSAPGAL
H2P4N6_BIK-01          LDPMEDFSPLECMEGSDALALRLACIGDEMDVSLRAPRRAQ--LPEVAMH
A0A2J8T301_BMF-01      LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVT
A0A2J8TYJ3_BAD-01      --------------SSAERGLGPSPAGDRPSGSSKHHRQAPGLLRDASHQ
A0A2J8TYJ3_BAD-02      --------------SSAERGLGPSPAGDRPSGSSKHHRQAPGLLRDASHQ
A0A2J8TYJ3_BAD-03      --------------SSAERGLGPSPAGDRPSGSSKHHRQAPGLLRDASHQ
                                                                         

H2NIS8_HRK-01          LHQRTMWRRRARSRRAPAPSALPTYWPWLCAAAQVAALAAWLLGRRNL--
H2NZD3_BBC3-01         RPRPAARCLPLRPHRPTRRHRRPGGPPLAGGSPQPAPRPAPGRSSALALA
H2NWG2_PMAIP1-01       PRGHEEQVQIAG--SRVCYSTQEIWRQTELPAETSESDIQTLLLRNLT--
H2NZD3_BBC3-02         AGGPTQ-----A--APGVRGEEEQWA------------------REIG--
H2P4N6_BIK-01          SLGLAFIYDQTEDIRDVLRSFTDGFTTLKENIMRFWSSLNPGSWVSRE--
A0A2J8T301_BMF-01      EEPQRLFYGNAG--------YRLPLPASFPAVLPTGEQPPEGQWQHRA--
A0A2J8TYJ3_BAD-01      QEQPTSSSHHGG---------RTWYSPSWESED--SENPSAGMLAEAS--
A0A2J8TYJ3_BAD-02      QEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRS--
A0A2J8TYJ3_BAD-03      QEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRS--
                                                                         

H2NIS8_HRK-01          --------------------------------------------------
H2NZD3_BBC3-01         GGAAPGVARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPAAADGGRPQ
H2NWG2_PMAIP1-01       -----------------------------------------------ASK
H2NZD3_BBC3-02         -----------------------------------------------AQL
H2P4N6_BIK-01          -----------------------------------------------QVL
A0A2J8T301_BMF-01      -----------------------------------------------EVQ
A0A2J8TYJ3_BAD-01      -----------------------------------------------AGM
A0A2J8TYJ3_BAD-02      -----------------------------------------------APP
A0A2J8TYJ3_BAD-03      -----------------------------------------------APP
                                                                         

H2NIS8_HRK-01          --------------------------------------------------
H2NZD3_BBC3-01         RAVRAAETRGAAAAPPLALEGPVQSHHGTPALTQGPQSPRDGAQLGACTR
H2NWG2_PMAIP1-01       TCMRGLLQKSFLRRCTFH-----------------QFEERLHCHW-----
H2NZD3_BBC3-02         RRMADDLNAQYERRRQEE-----------------QQRHR-PSPWRVLYN
H2P4N6_BIK-01          LALLLLLLSGGLHLLLK---------------------------------
A0A2J8T301_BMF-01      IARKLQCIADQFHRLHVQ-----------------QHQQNRNRVWWQILL
A0A2J8TYJ3_BAD-01      SAPAADSEAQHAENVKLEALGLWRSGVA---TAPTPRGRRTTKGWGRSPA
A0A2J8TYJ3_BAD-02      NLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQ
A0A2J8TYJ3_BAD-03      NLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQ
                                                                         

H2NIS8_HRK-01          ----------------------------
H2NZD3_BBC3-01         PVDVRDSGGRPLPPPDTLASAGDFLCTM
H2NWG2_PMAIP1-01       ----------------------------
H2NZD3_BBC3-02         LIMGLLPLPRGHRAPEMEPN--------
H2P4N6_BIK-01          ----------------------------
A0A2J8T301_BMF-01      FLHNLALNGEENRNGAGPR---------
A0A2J8TYJ3_BAD-01      PFGAVRARRPPISGQHSAMAASSGG---
A0A2J8TYJ3_BAD-02      SWWDRNLGRGSSAPSQ------------
A0A2J8TYJ3_BAD-03      SWWDRNLGRGSSAPSQ------------
                                                   

© 1998-2022Legal notice