Dataset for protein Bim of organism Piliocolobus tephrosceles

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****************************************                                       
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------------------------------------
                                         gnpegnhggegdscphgspqgplappaspgpfatrsplf
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                 : * :::   .    
---------------------drspapmscdkstqtpsppcqafnhylsamasrrqaepadmrpeirIaqelrrig----
ifmrrssllsrsssgyfsfdt--------------------------------------------vv ledmgdtslwfg
                                                                                
                                                                                
                                                                                

       170       180       190       200        
....:....|....:....|....:....|....:....|....:...
      * :. :::.                                 
------Defnayyarrvflnny--------------------------
fiftgl lyghhhsqdlekl--qaaedhpqmvilrllryivrlvwrmh
                tsq-phssts                      
                ma pldrdf                       
                     a                          
© 1998-2023Legal notice