Dataset for protein Bim of organism Piliocolobus tephrosceles

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C9I5G9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A8C9I5G9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A8C9I5G9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A8C9I5G9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A8C9I5G9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A8C9I5G9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
                        *****************************************         

A0A8C9I5G9_BCL2L11      --------------------------------------------------
A0A8C9I5G9_BCL2L11      --------------------------------------------------
A0A8C9I5G9_BCL2L11      --------------------------------------------------
A0A8C9I5G9_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A8C9I5G9_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A8C9I5G9_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
                                                                          

A0A8C9I5G9_BCL2L11      -------------------------------ASRRQAEPADMRPEIRIAQ
A0A8C9I5G9_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVI----------------
A0A8C9I5G9_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQ
A0A8C9I5G9_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQ
A0A8C9I5G9_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQ
A0A8C9I5G9_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQ
                                                       .                  

A0A8C9I5G9_BCL2L11      ELRRIGDE--FNAYYARRLAKLLASST-----------------------
A0A8C9I5G9_BCL2L11      -LEDMGDTSLWFGFIFTGLDLYGHHHSQDTEQLNHRDFS-----------
A0A8C9I5G9_BCL2L11      ELRRIGDE--FNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
A0A8C9I5G9_BCL2L11      ELRRIGDE--FNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
A0A8C9I5G9_BCL2L11      ELRRIGDE--FNAYYARRLEK-----------------------------
A0A8C9I5G9_BCL2L11      ELRRIGDE--FNAYYARRMSLPPD--------------------------
                         *  :**   : .:    :                               

© 1998-2022Legal notice