Dataset for protein Bim of organism Piliocolobus tephrosceles

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C9I5G9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A8C9I5G9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A8C9I5G9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A8C9I5G9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A8C9I5G9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A8C9I5G9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
                        *****************************************         

A0A8C9I5G9_BCL2L11      --------------------------------------------------
A0A8C9I5G9_BCL2L11      --------------------------------------------------
A0A8C9I5G9_BCL2L11      --------------------------------------------------
A0A8C9I5G9_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A8C9I5G9_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A8C9I5G9_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
                                                                          

A0A8C9I5G9_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAM--------------VVILE
A0A8C9I5G9_BCL2L11      -------------------------------ASRRQAEPADMRPEIRIAQ
A0A8C9I5G9_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQ
A0A8C9I5G9_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQ
A0A8C9I5G9_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQ
A0A8C9I5G9_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQ
                                                                     : * :

A0A8C9I5G9_BCL2L11      DMGDTSLWFGFIFTGLDLYGHHHSQDTEQLNHRDFS--------------
A0A8C9I5G9_BCL2L11      ELRRIG----------DEFNAYYARRLAKLLASST---------------
A0A8C9I5G9_BCL2L11      ELRRIG----------DEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYI
A0A8C9I5G9_BCL2L11      ELRRIG----------DEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYI
A0A8C9I5G9_BCL2L11      ELRRIG----------DEFNAYYARRMSLPPD------------------
A0A8C9I5G9_BCL2L11      ELRRIG----------DEFNAYYARRLEK---------------------
                        ::   .          * :. :::.                         

A0A8C9I5G9_BCL2L11      --------
A0A8C9I5G9_BCL2L11      --------
A0A8C9I5G9_BCL2L11      VRLVWRMH
A0A8C9I5G9_BCL2L11      VRLVWRMH
A0A8C9I5G9_BCL2L11      --------
A0A8C9I5G9_BCL2L11      --------
                                

© 1998-2023Legal notice