Dataset for protein Bik of organism Peromyscus maniculatus bairdii

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**********************************        **************************************
MSEARLMARDLIKTVLHDQVPRPPVAPGAPSMKE--------PVRDLDLAECLEDRNQVALRLAYIGDEMDLCLRSPRLA
                                  pveeenis                                      

        90       100       110       120       130       140       150         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
*******************************************************************************
QLPGIAMHRLAVTYSQTGVRGVFRSLIRGLTNLRENIWSWRVPTPGTWVLPDQARGQLFPMVLLVLLLLGGEALRLQLQ
                                                                               
© 1998-2022Legal notice