Dataset for protein Bik of organism Peromyscus maniculatus bairdii

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A6I9LKH4_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Peromyscus maniculatus bairdii GN=BIK (length=159 residues).
MSEARLMARDLIKTVLHDQVPRPPVAPGAPSMKEPVEEENISPVRDLDLAECLEDRNQVALRLAYIGDEMDLCLRSPRLA
QLPGIAMHRLAVTYSQTGVRGVFRSLIRGLTNLRENIWSWRVPTPGTWVLPDQARGQLFPMVLLVLLLLGGEALRLQLQ
>gnl|bcl2dbpro|A0A8C8U1G0_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Peromyscus maniculatus bairdii GN=BIK (length=151 residues).
MSEARLMARDLIKTVLHDQVPRPPVAPGAPSMKEPVRDLDLAECLEDRNQVALRLAYIGDEMDLCLRSPRLAQLPGIAMH
RLAVTYSQTGVRGVFRSLIRGLTNLRENIWSWRVPTPGTWVLPDQARGQLFPMVLLVLLLLGGEALRLQLQ
© 1998-2022Legal notice