Dataset for protein classical BH3-containing proteins of organism Papio anubis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------makqpsdvssecdre----------------------------grqlqPaerppql
ikfgvgsaracpcqvprassatwv--qi-----------pggqlpgarrgpgprrpaplparppgal--vfersdqedg-
                        pf--cgpcvrvledd                            tse-mqgrgarsa
                         cmevrrsrelilvt                            sl-ys ekkrlkn
                         msgme rpikgpmg                            qhler lqv  av
                          pc   qechfgl                             ddrah vps  ts
                               i  de a                              a  c cle   m
                                                                           a   c
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
rpgaptslqtepqg------g----------p---p-----p--------------------------------------
-assergagpsaa-npegnh-geglfpldsc-ggs-qgplq-tpgrssalalaggaapgvaraqrpggpggrshpggpgs
qspgslr-dlf--sdkpspssrhhrpigrqachplwrpshaq                                      
artwvpqq---lsvlldcdlrklqfgg thlhwlgldatsse                                      
sqrragp iartrltchtqtdqfr    pp aftrvkklvrs                                      
lvl   d argsp ragrar  a     m   a  seedpe                                       
e c   c  ccqe e a                     agd                                       
c                                                                               
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------a-t-p-a--sp----mr--sll----s-------drspapmscdks
prgggtvgpgdrgpaaadggrpqravraaetrgp-s-g-l-tr--lqif--rs---srss-gyfsfdteeptpfrrvprl
                                 eqapssfghggasfvvtlpcavtyepqrefygsqlyarsv-vgrsav
                                 dkpaqtshpeetvagehgtrgssepagtlrdenmgg-l-swldfrd-
                                 apwfperelalrgsshe sphywqgrrlpendgaeaqcrrsa-a--n
                                 sel r i cq qrmpld narqita kwqsqaalp-p-glr-l-vyi
                                 m d l   am d dmda glqders  ekql de vnve-ky tqed
                                     d         a    h cag     le    rlmdmew ql  
                                                      a d     a     hha  cs  g  
                                                                             e  
                                                                             a  
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
tqtpsppcqa---------fnhylsama------------------------------------------r---------
aplglqaaetqwqhralvs-gr--q-i-srfvrshvqglrqaepadmrpeiriaqelrrigdefnayyar-vslapsqva
lrrsew-pdr     deaqya-kact-vdqahdlfwkqhprprtrvtltimlqttswtlnfqswwrrvlplgfvnnysar
rgpnalg---      klti-qre-rvsvelllawtrlvqenksdswwqqlvgssgyaevpernrqgndg pwtsrrhsv
g-m---ftps        nawdf rnrgrk fg grl gtdeinvpsawfrnflhnkgcyimphsnatwq ytswsqeel
-iitvv mlg         lrpe pelyqw ac ak   lsdvvsglpsvgfrflt d s klqpdvrnk spkpqla g
w -  t lhp         e  w lcakpv         i  srpqa rladlhk      hh kesqe  nlnlgg   
p q     fe            h ef inp         e  lgg   lg    a      gc g lpc  mk hff   
  a                     a  eln         d  ad    g            a    dl   lh d e   
                            ii         a                           f   ee   d   
                            gf                                         c        
                            a                                                   

       330       340   
....:....|....:....|...
                       
-----------------------
edhpqmvilrllryivrlvwrmh
lltsssfrsvqpllsgg hlllk
malqwpllcmkae          
khknllga l  c          
g clig   c             
  aa                   
                       
                       
                       
                       
                       
© 1998-2021Legal notice