Dataset for protein classical BH3-containing proteins of organism Papio anubis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------mpp--sessleervlqp--gppgarpgsstslqleaqg--l----------p
ikfgvgsaracpcqvprassamfqmpkq--dvsmvelsapdqfgrepseaqlqasapgqahtrppsll-dasrsrlqlts
                     twviaeips-sredcerygsptsaaer---dk--d-lkhgrq---dqwtfplqqenpn-
                      sgvrqfeeseqc--daqdqler vd-r a--lt-r--td-fvsmak ncthlkklvft
                        pcp srgqp-rt-mcrkgah srtq  vlgevedr -m-sla   h rqkl   va
                            cg klaplnk qhn e qa a  te cgaca tfgrg      a      s 
                               ik lkk   c    g      c          if             i 
                                   g                a                           
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
s-hhgg-g--------------pe--lq--esp-plgtrs------------------------d-lpapmscraststp
-t----p-avetrsrdscyhgs-ret--pp---s-f--aeplfifmrrssllsrsssgyfsfdt-rssl---rprqrq-g
lsnccpe        rawpspgl-ppsaeekatqt-ap-- sqgv lpcgvteepqrlfyrwrgym---tywedkaq-y-
eglasat        h s pa wqgdvsvdawrgeyslql                    psqsvlrqrrvt----etry
kpf l r               v sqggmmrnfvcrrgm                     irmqtehncqtnlwpv-rqv
dl    a               t  eee aqearaimc                      gngdedaa gpefsgtlplr
                      h   dd   d d  ea                      alaa     elaaidddmiq
                                                                      a  e   lfl
                                                                             eea
                                                                              d 

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
spppqasrvy---amaslrla-padwrreir--q----------------------------------------------
rhaep-lntllswlqkgrp--pl--t-pgrera-nwrrigdefwaillflhnlalngeenrngvdpyrlnrrryarslsv
a-rc-vf-q-wgv---a-gqqeiyrqt----itseltsvprvwnt                     rykpipsswprvnp
-r--tr-whvvpsyrr-v-vrrctpmqtrqhvspvqqnsnqs tq                     lnegamptvgqqkl
qqnrspwp-hselwnprmqrpk-pl-plqp qqks   rmap gd                     a a  g fs kpfk
llllrmqlkfrdgvklpakalftfghlhdm nlgp   ff g                                   hea
ee ankkkeciaefdii f  cs eghfal mhdh                                             
    gg d a    ch  a  a  a fd e lgcg                                             
    e  a                  a     e                                               
                                                                                

       250       260       270   
....:....|....:....|....:....|...
                                 
---------------------------------
ssyvsreqvpqmvllrllrylvrlvwrmhlllk
rnwsagqphllali l allial sggl     
nafq cgde                        
m al a                           
                                 
                                 
                                 
                                 
                                 
© 1998-2020Legal notice