Dataset for protein classical BH3-containing proteins of organism Papio anubis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mfpaaaagaargrgaacgalgcpaecggglagrrglcaapgtlnpspelcflrclrgdgqgapgrrrsrcvrpgardvfq
                            ikf vgsar c cqvprassatwvp qicgprerh mepagareeledarak
                                                                p tp gql    rgpg
                                                                              i 
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------makqpsdvsse-cdregrqLqpaerp--pqlrpgaptslqtepqgrp-------------------
plrgepkarpkssqsgslfrqsllditplsrlrpfllthccg-g---tsqedkarqtlqpalawgspqpaprptpgrssa
tedssggpqtgpdlrrdvsawl--- pgcypsl ra----  l-pva-r--artmrvtdnt                   
frvpaarmcrckvpv rsltpirmr  lpreq  l rssl  es t s-lk- hgglh--s                   
 g    l a pqlhl piapa pcq  a qag  g eq a  ap   h  gr gd  g v-                   
           mgg   g     a          e  a         a           a                    
             a                                                                  
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------------------------------dgdrspapmscdkstqtpspp
lalaegnhggegdscphgspqgplappaspgpfatrsplfifmrrssllsrsssgyfsfpt------awfrevr------
    g aap varaqrp g gersh mgpgs wggmt sqgv lpcgvteepqrlfygn--ymlqlrvrapatlsrvatr
    d               e d d gedfd lecge           vgpgd  paaaaav pereqaririgmqrrrm
                                                            sg gaeal  agdegdl la
                                                                        a aaa   
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
cqafnhyls-amas-rqaepadmrpeiriaqelrrigdefnayyar--r--l----------------------------
---------v----rppvqqwqqtadvslwrvsqnl--ql--lhv-qv-vf-npyqqsedhpqmvwlrllrylvrlvwrm
aprlptqye pigeqgmegi-hhatrsq-gpkr-c-am--hr--rqirtwevennpaawvsrsrtlwqiglfihtmllng
pgd aqlwp  lhllal---yevihlptw-lgfy-tmlg yththshmqpwrswlgstqqp pqiissa dsfgscgcll
 d   a s      ewrrvsl g gglaqliq psniad tpcr-nedpmsmrhkdrrpln nk  aa   l cn aah 
                 cfeh e daa p fa iff    lg peg  alqkpddagh    ed         al     
                  aae d       d         g        fp     f                       
                                                 ed                             

       330       340        
....:....|....:....|....:...
                            
----------------------------
hggrnwmsprpstwsstvvnpplsthvp
senphlllkl lslngal kcc      
qd l gadi                   
e                           
                            
                            
                            
© 1998-2022Legal notice