Dataset for protein classical BH3-containing proteins of organism Papio anubis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mfpaaaagaargrgaacgalgcpaecggglagrrglcaapgtlnpspelcflrclrgdgqgapgrrrararrpgararaq
                            ikf vgsar c cqvprassatwvp qicgprerh p tpggqlmpikrgvg
                                                                          g kark
                                                                            f p 
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------makqpsdvssecdregrqlqpaerppqlrpga----------------------ptslqtepq--p
tlrsepkartkmpq----mrpsrcveglypgvflletge-kpv-ssslsadlfaqslldcplsrlqlf-larcrg-ggn-
saqpsgtrarpkdgvssvtevpqartecsedrqghsdsslgaqs-r                      l-th-c-h-lrv
pr ac lqvqmpsrtrptswtlpqqsssrdslprarsmlk---dh-                      kk--p-rgtvwg
n   a cp  aggcpphrlpsilmiplpqiqm e lqhges taag                       hr hgp lqqd
           cfallgigggecedaafga g   fpacdp s                          gh gd  eepa
              igefe  a d    a       a aa                                aa    l 
              a  aa                                                           a 
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------s---------l-p--------------------------------------drspapmscdkstqtpsppc
egnhggegd-cphgspqgp-a-paspgpfatrsplfifmrrssllsrssspwggyfsfdteepqrrflgnagyrrvlsas
tsqrseqtqtlgpigrsqgvmlecgvt gva aqrpggpggr hpggpg    swtvepssqystl-yrertrsmtaiwr
vvwedkapyptseawgrtwysadtlna                          lgemg ganleltrwarqqaplsvalt
qtvqqrvltwsrtp a srrp ag e                            ec     mha alqeglpqhkrr gp
pahpepdea rqdh   lefd  d a                                   lg   ad ciadeadc  g
l dg   c  me     aa                                          d                 e
a a       a                                                                     
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
qafnhylsama-------------------rrqeepadmrpe-riaqelrrigd-f-a--arr-----------------
fpavlpigelpmkslglafiydqtddirds--paatwq--a-i---rg------e-n-yy---vqlnlyqvasshpqmli
vsyaaqwpwv-lha               lpqgvgqgstt-rvslg--wqctaaqlhrlhvpqdfwsrnhawlqplltva
trrrtitrrqv                  vll--raphhpwnrqwwpkspnsplp ggsthqvtwvpnewspedl dsfh
lqlpqhmepct                  wigshqslpvnrlltrtlqrifn  d y hrrsesvtqpsrrlwpi  l g
glkl fa n k                   h ffmrhfgelgenqmkff  l      cpn  ptrdgqkldfa   f  
d g  a  l c                   e edigdeca aaa lia          a    msq  ggk         
a e                             d  d          f                lpk  d i         
                                                               hee              

       330       340       350    
....:....|....:....|....:....|....
                                  
----------------------------------
lrllrysvglvwrmhrpstwsstvvnpplsthvp
slganligrrnlmspl lslngal kcc      
nvmdlgqtnphgllk                   
 cachseem   adi                   
 a  f cd                          
    a                             
                                  
                                  
© 1998-2023Legal notice