Dataset for protein classical BH3-containing proteins of organism Papio anubis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
ikfgvgsaracpcqvprassatwvpcqicgprerhgprtpggqlpgarrgpgprrpaplparppgalgsvlrplrarpgc
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------makqpsdvssecdregrqlqpaerppqlrpga
rprrprpaarclplrphrptrrhrrpggpplawgspqpaprptpgrss------------------fesgdgeds--sss
                                                afqimepsrcveelqdde-mrskqsrgaqrp-
                                                 mslvvgiargvpmavpvysqevkalkncq-t
                                                 lpggr a pdilc tlrikfltwvhtvavlg
                                                 iafag    a a  q pgh  re arqice 
                                                 c c             lag  l   pmgac 
                                                                      g   cge   
                                                                          a     
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
ptslqtepqg------g------g--cp---p-----------p-----p-----r--s------s-------drspapm
ergagps-a-npegnh-glqlfe-ds--ggs-qgplqppastg-latrs-sfifm-rs-llsrss-gyfsfdteepsvfa
slr-d--a-sdkpsdssrf   hhtqachllwdassaqeqppssfhhggalqgvtlpcgvtyppqrllyasqeylltr-v
-g-g-lfqpvllgcplrk    plrhpqtpglrpthredkasqtsgpaetgsvewvsrhsseeagtefdgnaggacrpvr
v-d aavllatrdtqvpq    d grilrqvrftrtngavlfp  elm dvasthgtpaaaqstrwreeegmv----ltl
r a   pge eeapardh    a fp gma heserkkmed d   ce   dple glriwglqplqsnqvlpvnvq-s-
a     g    c  vqa        g      aed d l             mha  hqdidg kgprldpglpkmgsry
           a   a                                    a      cc a aah k l hl hd es
                                                                      e da    c 
                                                                      a         
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
scdkstqtps-------ppcqafnhylsamasr---------p-------------------------------------
gr--la--slvlpigeqwaagtwar-aefl-a-rqdepadmr-ririaqelrrigdefnayyarrvwlarnqererhppm
dvrr--prnaqaap vrgfpdqlgse---qi-ellasiksqlhepkvqttqtqrrrhwwwtrlflsfwnnylaagssgqs
-psdirgp-e     paveeesyr-rgrv-cdmkvqagdkgfgflhtfphaqnmnqvssqilvpqnnkdpsggendnlvl
wfgaagslt-       tdt-r-qqawdrvvtkfeeifvasywlgqsrlqpdvyvsshrevtnqkmsvsllpvqppvald
raqe wrqrv       q ml-s-tksqnisrwadvcwtvlwsirlrpgg  lntmtqgysqwlihhpqarcrllatsgq
l-p    m t       l khnep hipw llqtftvvrtcvlgmfqnef  hlplrlfvrpshcpggpseapgh l e 
ate    g            fe e d lt yvinagltnraie aeke a  gcihpk rl e ale lfd k   g   
 q                         g  knfm cdsl   a  dg     e  g    g    e          a   
                           a  giai   rg                     e    c              
                                 e   l                      d                   
                                 d   a                                          

       330       340    
....:....|....:....|....
                        
------------------------
vilrllryivrlvwrmhflsvqpn
qryltasssggkmllss   mk e
pvvmnwqrpf clkalk   ce c
sspkatnlg   h           
lagg  lia               
h      g                
                        
                        
                        
                        
                        
© 1998-2020Legal notice