Dataset for protein classical BH3-containing proteins of organism Papio anubis

[Download (right click)] [Edit] [Sequences] [Repertoires]

14 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3M5R0_PMAIP1-      --------------------------------------------------
A0A2I3N2Z9_BBC3-02      --------------------------------------------------
A0A096NTE9_BMF-01       --------------------------------------------------
A0A096NTE9_BMF-02       --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------------------
A0A096NKG5_BIK-01       --------------------------------------------------
A0A2I3MFC0_BAD-01       --------------------------------------------------
A0A2I3N2Z9_BBC3-01      ----------------------------IKFGVGSARACPCQVPRASSAT
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      MFPAAAAGAARGRGAACGALGCPAECGGGLAGRRGLCAAPGTLNPSPELC
A0A096NYC3_BCL2L11      MFPAAAAGAARGRGAACGALGCPAECGGGLAGRRGLCAAPGTLNPSPELC
                                                                          

A0A2I3M5R0_PMAIP1-      ----------------------MPGKKARKNAQPSPTRAQAGPGTAGTAG
A0A2I3N2Z9_BBC3-02      ------------------------IKFGVGSARACPCQV---PRASSATW
A0A096NTE9_BMF-01       ------------------------------------------------ME
A0A096NTE9_BMF-02       ------------------------------------------------ME
A0A096N944_HRK-01       ----------------------------------------MCPCPLHRGR
A0A096NKG5_BIK-01       -----------------------------------------MSGVRPISR
A0A2I3MFC0_BAD-01       -----------------------------------------MFQIPEFEP
A0A2I3N2Z9_BBC3-01      WVPCQICGPRERHGPRTPGGQLPGARRGPGPRRPAPLPARPPGALGSVLR
A0A096NYC3_BCL2L11      --------------------------------------------MAKQPS
A0A096NYC3_BCL2L11      --------------------------------------------MAKQPS
A0A096NYC3_BCL2L11      --------------------------------------------MAKQPS
A0A096NYC3_BCL2L11      --------------------------------------------MAKQPS
A0A096NYC3_BCL2L11      FLRCLRGDGQGAPGRRRARARRPGARARAQTLRSEGKARTKKDQMAKQPS
A0A096NYC3_BCL2L11      FLRCLRGDGQGAPGRRRARARRPGARARAQTLRSEGKARTKKDQMAKQPS
                                                                          

A0A2I3M5R0_PMAIP1-      TARDQAGFGIGMQLHFTRSKKLVSSS----------------------PL
A0A2I3N2Z9_BBC3-02      VPCQICGPQPSLLLAEQHLESPVPSA----------------------PG
A0A096NTE9_BMF-01       PSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPL
A0A096NTE9_BMF-02       PSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPL
A0A096N944_HRK-01       GPPAVCACSAGRLGLRSSAAQLTAAR----------------------LK
A0A096NKG5_BIK-01       DILMETLLYEQLLEPLTME-------------------------------
A0A2I3MFC0_BAD-01       SEQEDSSSAERGLGPSPAGDKPSDSG----------------------KH
A0A2I3N2Z9_BBC3-01      PLRARPGCRPRRPRPAARCLPLRPHR----------------------PT
A0A096NYC3_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGA----------------------PT
A0A096NYC3_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGA----------------------PT
A0A096NYC3_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGA----------------------PT
A0A096NYC3_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGA----------------------PT
A0A096NYC3_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGA----------------------PT
A0A096NYC3_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGA----------------------PT
                                                                          

A0A2I3M5R0_PMAIP1-      ALPRGHEEQVQVARSRVCYSTQEIWRQTELPAETSE--------------
A0A2I3N2Z9_BBC3-02      ALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLN--------------
A0A096NTE9_BMF-01       THCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVT-------------
A0A096NTE9_BMF-02       THCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVT-------------
A0A096N944_HRK-01       ALGD----------------------------------------------
A0A096NKG5_BIK-01       -------VLGVTDPEEDLDPMED------FDP------------------
A0A2I3MFC0_BAD-01       HRQAPGLLWDASHQQEQPTSSSHHGGRAWYSP------------------
A0A2I3N2Z9_BBC3-01      RRHRRPGGPPLAWGSPQPAPRPTPGRSSALALAGGAAPGVARAQRPGGPG
A0A096NYC3_BCL2L11      SLQTEPQ-------------------------------------------
A0A096NYC3_BCL2L11      SLQTEPQ-------------------------------------------
A0A096NYC3_BCL2L11      SLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMR
A0A096NYC3_BCL2L11      SLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMR
A0A096NYC3_BCL2L11      SLQTEPQ-------------------------------------------
A0A096NYC3_BCL2L11      SLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMR
                                                                          

A0A2I3M5R0_PMAIP1-      --------------------SDSQTLLLRNLTASKTCIGGLQKRLFLRRC
A0A2I3N2Z9_BBC3-02      --------------------AQYERRRQEEQQRHRPSPWRVLYNLIMGLL
A0A096NTE9_BMF-01       --------------------EEPQRLFYGNAGYRLPLPASFPAVLPIGEQ
A0A096NTE9_BMF-02       --------------------EEPQRLFYGNAGYRLPLPASFPAVLPIGEQ
A0A096N944_HRK-01       --------------------ELHQRTMWRRRARSRRAPAPGALPTYWPWL
A0A096NKG5_BIK-01       -------------LECMEDSDMLALR-LACIGDEMDVSLRAPRLAQLSEV
A0A2I3MFC0_BAD-01       -------------SWESEDSENPSARMLAEASAPMSAPATDSEAQHAENV
A0A2I3N2Z9_BBC3-01      GRSHPGGPGSPWGGGTVGPGDRGPAAADGGRPQRAVRAAETRGAAATPPL
A0A096NYC3_BCL2L11      --------------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAM
A0A096NYC3_BCL2L11      --------------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAM
A0A096NYC3_BCL2L11      RSSLLSRSSS---GYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM
A0A096NYC3_BCL2L11      RSSLLSRSSS---GYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM
A0A096NYC3_BCL2L11      --------------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAM
A0A096NYC3_BCL2L11      RSSLLSRSSS---GYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM
                                                                          

A0A2I3M5R0_PMAIP1-      T------------------LHQFEERLHCNW-------------------
A0A2I3N2Z9_BBC3-02      P------------------LPRGHRAPEMEPN------------------
A0A096NTE9_BMF-01       P---------------------PEGQWQHRAEVQIARKLQCIADQFHRLH
A0A096NTE9_BMF-02       P---------------------PEGQWQHRAEVQIARKLQCIADQFHRLH
A0A096N944_HRK-01       C-----------------------AAAQVAALAAWLLGRRNL--------
A0A096NKG5_BIK-01       AMHSLGLAFIYDQTDDIRDVLRSFMDGFTTLRENIMRFWR--------SP
A0A2I3MFC0_BAD-01       KLKALGL------------WRRGVATAPTPRGRRRTKGWRRSPAPFGAAR
A0A2I3N2Z9_BBC3-01      A------------------LEGPVQSHHGTPALTQGPQSPRNGAQLGACT
A0A096NYC3_BCL2L11      ----------------------DEATGS-----SLGIAL-----------
A0A096NYC3_BCL2L11      V------------------VILEDIGDS-----SLWFGFIFTGLDLYGHH
A0A096NYC3_BCL2L11      A------------------SRRQAEPADMRPEIRIAQELRRIGDEFNAYY
A0A096NYC3_BCL2L11      A------------------SRRQAEPADMRPEIRIAQELRRIGDEFNAYY
A0A096NYC3_BCL2L11      A------------------SRRQAEPADMRPEIRIAQELRRIGDEFNAYY
A0A096NYC3_BCL2L11      A------------------SRRQAEPADMRPEIRIAQELRRIGDEFNAYY
                                                                          

A0A2I3M5R0_PMAIP1-      --------------------------------------------------
A0A2I3N2Z9_BBC3-02      --------------------------------------------------
A0A096NTE9_BMF-01       VQQHQQNRNRVWWQILLFLHNLALNGEENRNGADPRPLTWNGAVVKPC--
A0A096NTE9_BMF-02       VQQT----SKIWSQ---SFGSCGCHGQDGPNWMSILPSSLSSTLVNCPLS
A0A096N944_HRK-01       --------------------------------------------------
A0A096NKG5_BIK-01       NPRSWVSREQVLLALLLLLALLLALLSGGLHLLLK---------------
A0A2I3MFC0_BAD-01       APRPPTSGQHS----------VMAASSGG---------------------
A0A2I3N2Z9_BBC3-01      RPVDVRDLGGRPLPPPDTLASAGDFLCTM---------------------
A0A096NYC3_BCL2L11      HREVQWPLEWLASS------------------------------------
A0A096NYC3_BCL2L11      HSQDTEQLNHKDFS------------------------------------
A0A096NYC3_BCL2L11      ARRLEK--------------------------------------------
A0A096NYC3_BCL2L11      ARRMSLPPD-----------------------------------------
A0A096NYC3_BCL2L11      ARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH---------------
A0A096NYC3_BCL2L11      ARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH---------------
                                                                          

A0A2I3M5R0_PMAIP1-      ----
A0A2I3N2Z9_BBC3-02      ----
A0A096NTE9_BMF-01       ----
A0A096NTE9_BMF-02       THVP
A0A096N944_HRK-01       ----
A0A096NKG5_BIK-01       ----
A0A2I3MFC0_BAD-01       ----
A0A2I3N2Z9_BBC3-01      ----
A0A096NYC3_BCL2L11      ----
A0A096NYC3_BCL2L11      ----
A0A096NYC3_BCL2L11      ----
A0A096NYC3_BCL2L11      ----
A0A096NYC3_BCL2L11      ----
A0A096NYC3_BCL2L11      ----
                            

© 1998-2023Legal notice