Dataset for protein classical BH3-containing proteins of organism Papio anubis

[Download (right click)] [Edit] [Sequences] [Repertoires]

12 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A096NTE9_BMF-01       --------------------------------------------------
A0A096NTE9_BMF-02       --------------------------------------------------
A0A2I3N2Z9_BBC3-01      ----------------------------IKFGVGSARACPCQVPRASSAT
A0A096NKG5_BIK-01       --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      MFPAAAAGAARGRGAACGALGCPAECGGGLAGRRGLCAAPGTLNPSPELC
A0A096NYC3_BCL2L11      MFPAAAAGAARGRGAACGALGCPAECGGGLAGRRGLCAAPGTLNPSPELC
A0A2I3N2Z9_BBC3-02      --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
                                                                          

A0A096NTE9_BMF-01       --------------MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFA
A0A096NTE9_BMF-02       --------------MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFA
A0A2I3N2Z9_BBC3-01      WVPCQICGPRERHGPRTPGGQLPGARRGPGPRRPAPLPARPPGALGSVLR
A0A096NKG5_BIK-01       -----------------------------------------MSGVRPISR
A0A096NYC3_BCL2L11      --------------------------------------------MAKQPS
A0A096NYC3_BCL2L11      --------------------------------------------MAKQPS
A0A096NYC3_BCL2L11      FLRCLRGDGQGAPGRRRARARRPGARARAQTLRSEGKARTKKDQMAKQPS
A0A096NYC3_BCL2L11      FLRCLRGDGQGAPGRRRARARRPGARARAQTLRSEGKARTKKDQMAKQPS
A0A2I3N2Z9_BBC3-02      ----------------------------IKFGVGSARACPCQVPRASSAT
A0A096N944_HRK-01       -------------------------------------MCPCPLHRGRGPP
A0A096NYC3_BCL2L11      --------------------------------------------MAKQPS
A0A096NYC3_BCL2L11      --------------------------------------------MAKQPS
                                                                          

A0A096NTE9_BMF-01       QSLLD-CPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPA---------
A0A096NTE9_BMF-02       QSLLD-CPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPA---------
A0A2I3N2Z9_BBC3-01      PLRAR-PGCRPRRPRPAARC--LPLRPHRPTRRHRRPGGPPLAWGSPQPA
A0A096NKG5_BIK-01       DILME-TLLYEQLLEP----------------LTMEVLGVT---------
A0A096NYC3_BCL2L11      DVSSE-CDREGRQLQPAERP--PQLRPGAPTSLQTEPQGNP---------
A0A096NYC3_BCL2L11      DVSSE-CDREGRQLQPAERP--PQLRPGAPTSLQTEPQGNP---------
A0A096NYC3_BCL2L11      DVSSE-CDREGRQLQPAERP--PQLRPGAPTSLQTEPQGNP---------
A0A096NYC3_BCL2L11      DVSSE-CDREGRQLQPAERP--PQLRPGAPTSLQTEPQ------------
A0A2I3N2Z9_BBC3-02      WVPCQICGPQPSLLLAEQHL--ESPVPSAPGALAGGPTQAA---------
A0A096N944_HRK-01       AV----CACSAGRLGLRSSA--AQLTAARLKALGDELHQRT---------
A0A096NYC3_BCL2L11      DVSSE-CDREGRQLQPAERP--PQLRPGAPTSLQTEPQDRS---------
A0A096NYC3_BCL2L11      DVSSE-CDREGRQLQPAERP--PQLRPGAPTSLQTEPQDRS---------
                                                                          

A0A096NTE9_BMF-01       ----------------------------------------------SPSQ
A0A096NTE9_BMF-02       ----------------------------------------------SPSQ
A0A2I3N2Z9_BBC3-01      PRPTPGRSSALALAGGAAPGVARAQRPGGPGGRSHPGGPGSPWGGGT---
A0A096NKG5_BIK-01       --------------D--------------PEEDLDPMEDFDPLECME---
A0A096NYC3_BCL2L11      --------------EGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
A0A096NYC3_BCL2L11      --------------EGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
A0A096NYC3_BCL2L11      --------------EGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2I3N2Z9_BBC3-02      --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
                                                                          

A0A096NTE9_BMF-01       GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVL----------------
A0A096NTE9_BMF-02       GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVL----------------
A0A2I3N2Z9_BBC3-01      --------VGPGDRGPAAADGGRPQRAVRAAETRGAAATP----------
A0A096NKG5_BIK-01       -------------------DSDMLALRLACIGDEMDVSLRAPRLAQLSEV
A0A096NYC3_BCL2L11      IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLS-
A0A096NYC3_BCL2L11      IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLS-
A0A096NYC3_BCL2L11      IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLS-
A0A096NYC3_BCL2L11      ---------------------DRSPAPMSCDKSTQTPSPPCQAFNHYLS-
A0A2I3N2Z9_BBC3-02      -------------------PGVRGEEEQWAREIGAQLRRMADDLNAQYE-
A0A096N944_HRK-01       ---------------------------MWRRRARSRRAPAPGALPTYWP-
A0A096NYC3_BCL2L11      -------------------PA-----PMSCDKSTQTPSPPCQAFNHYLS-
A0A096NYC3_BCL2L11      -------------------PA-----PMSCDKSTQTPSPPCQAFNHYLS-
                                                                          

A0A096NTE9_BMF-01       PIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQ----------QHQQ
A0A096NTE9_BMF-02       PIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQ----------QT--
A0A2I3N2Z9_BBC3-01      PLALEGPVQSHHGTPALTQGPQSPRNGAQLGACTR---PVDVRDLGGRPL
A0A096NKG5_BIK-01       AMHSLGLAFIYDQTDDIR--DVLRSFMDGFTTLRENIMRFWRSPNPRSWV
A0A096NYC3_BCL2L11      AMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYAR--RMSLPPD-----
A0A096NYC3_BCL2L11      AMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYAR--RLEK--------
A0A096NYC3_BCL2L11      AMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYAR--RVFLNNYQAAED
A0A096NYC3_BCL2L11      AMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYAR--RVFLNNYQAAED
A0A2I3N2Z9_BBC3-02      -----RRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN-----
A0A096N944_HRK-01       -----WLCAAAQVAALAAWLLGRRNL------------------------
A0A096NYC3_BCL2L11      -----AM----DEATGSSLGIAL-----------HREVQWPLEWLASS--
A0A096NYC3_BCL2L11      -----AMVVILEDIGDSSLWFGFIFTGLDLYGHHHSQDTEQLNHKDFS--
                                                                          

A0A096NTE9_BMF-01       NRNRVWWQILLFLHNLALNGEENRNGADPRPLTWNGAVVKPC------
A0A096NTE9_BMF-02       --SKIWSQ---SFGSCGCHGQDGPNWMSILPSSLSSTLVNCPLSTHVP
A0A2I3N2Z9_BBC3-01      PPPDTLASAGDFLCTM--------------------------------
A0A096NKG5_BIK-01       SREQVLLALLLLLALLLALLSGGLHLLLK-------------------
A0A096NYC3_BCL2L11      ------------------------------------------------
A0A096NYC3_BCL2L11      ------------------------------------------------
A0A096NYC3_BCL2L11      HPQMVILRLLRYIVRLVWRMH---------------------------
A0A096NYC3_BCL2L11      HPQMVILRLLRYIVRLVWRMH---------------------------
A0A2I3N2Z9_BBC3-02      ------------------------------------------------
A0A096N944_HRK-01       ------------------------------------------------
A0A096NYC3_BCL2L11      ------------------------------------------------
A0A096NYC3_BCL2L11      ------------------------------------------------
                                                                        

© 1998-2022Legal notice