Dataset for protein classical BH3-containing proteins of organism Papio anubis

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A096N944_HRK-01       ----------------MCPCPLHRGRGPPAVCACSAGRLGLRS-------
A0A096MLD5_BAD-01       MFQIPEFEPSEQEDSSSAERGLGP--SPAGDKPSDSGKHHRQAPGLLWDA
A0A096MLD5_BAD-02       MFQIPEFEPSEQEDSSSAERGLGP--SPAGDKPSDSGKHHRQAPGLLWDA
A0A096NKG5_BIK-01       MSGVRPISRDILMETLLYEQLLEP--------------LTMEVLG-----
A0A096NYC3_BCL2L11      ---MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQG-----
A0A096NYC3_BCL2L11      ---MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQG-----
A0A096MPU8_PMAIP1-      -------MPGKKARKNAQPSPTRAQAGQAGTAGTARDQAGFGIGMQLHFT
A0A2I3N2Z9_BBC3-03      ---------------------IKFGVGSARACP---------------CQ
A0A096NTE9_BMF-03       -------MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCP
A0A096NTE9_BMF-01       -------MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCP
                                                                          

A0A096MPU8_PMAIP1-      ------------------------------MPGKKARKNAQPSPTRAQA-
A0A096N944_HRK-01       -------SAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWP
A0A096MLD5_BAD-01       SHQQEQPTSSSHHGGAGAVETRSRHSSYPAGTEEDEGMEEEPSPFRGRS-
A0A096MLD5_BAD-02       SHQQEQPTSSSHHGG---------RAWYSPSWESEDS--ENPSARMLAE-
A0A096NKG5_BIK-01       -------VTD---------------------PEEDLDPMEDFDPLECME-
A0A096NYC3_BCL2L11      -------NPEGNHGGEG-------DSCPHGSPQGPLAPPASPGPFATRSP
A0A096NYC3_BCL2L11      -------NPEGNHGGEG-------DSCPHGSPQGPLAPPASPGPFATRSP
A0A096MPU8_PMAIP1-      RSKKLVSSSPLALPRGHEEQVQVARSRVCYSTQEIWRQTELPAETSESD-
A0A2I3N2Z9_BBC3-03      VPR-------------------------------ASSATWVPCQICGPQ-
A0A096NTE9_BMF-03       LSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEP-
A0A096NTE9_BMF-01       LSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEP-
                                                                          

A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A096N944_HRK-01       WLCAAAQVAALAAWLLGRRNL-----------------------------
A0A096MLD5_BAD-01       -------------------------RSAPPNLWAAQRYGRELRRMSDEFV
A0A096MLD5_BAD-02       -------------------------ASAPMSAPATDSEAQHAENVKLKAL
A0A096NKG5_BIK-01       ---------------------DSDMLALRLACIGDEMDVSLRAPRLAQLS
A0A096NYC3_BCL2L11      LFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYL
A0A096NYC3_BCL2L11      LFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYL
A0A096MPU8_PMAIP1-      -----SQTLLLRNLTASKTCIGGLQKRLFLRRCTLHQFEERLHCNW----
A0A2I3N2Z9_BBC3-03      -----PS--LLLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREI
A0A096NTE9_BMF-03       -----QR--LFYAPAEPKSRVVADP------PL-----PAQPCFEWRR--
A0A096NTE9_BMF-01       -----QR--LFYGNAGYRLPLPASF------PAVLPIGEQPPEGQWQHRA
                                                                          

A0A096MPU8_PMAIP1-      ---------------ELEVECATQLRRFGDKLNFRQKLLNLIAKLFCSGT
A0A096N944_HRK-01       --------------------------------------------------
A0A096MLD5_BAD-01       DSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ----
A0A096MLD5_BAD-02       GLWRRGVA---TAPTPRGRRRTKGWRRSPAPFGAARAPRPPTSGQHSVMA
A0A096NKG5_BIK-01       EVAMHSLGLAFIYDQTDDIR--DVLRSFMDGFTTLRENIMRFWRSPNPRS
A0A096NYC3_BCL2L11      S-AMASRRQAEPADMRPEIRIAQELRRIGDEFNAY------YARRLEK--
A0A096NYC3_BCL2L11      S-AMASRRQAEPADMRPEIRIAQELRRIGDEFNAY------YARRVFLNN
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      GAQLRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRA
A0A096NTE9_BMF-03       ---------------------------------------------EQERG
A0A096NTE9_BMF-01       EVQIARKLQCIADQFHRLHVQQHQQNRNRVWWQILLFLHNLALNGEENRN
                                                                          

A0A096MPU8_PMAIP1-      -------------------------------
A0A096N944_HRK-01       -------------------------------
A0A096MLD5_BAD-01       -------------------------------
A0A096MLD5_BAD-02       ASSGG--------------------------
A0A096NKG5_BIK-01       WVSREQVLLALLLLLALLLALLSGGLHLLLK
A0A096NYC3_BCL2L11      -------------------------------
A0A096NYC3_BCL2L11      YQAAEDHPQMVILRLLRYIVRLVWRMH----
A0A096MPU8_PMAIP1-      -------------------------------
A0A2I3N2Z9_BBC3-03      PE---------------------MEPN----
A0A096NTE9_BMF-03       GP-----------------------------
A0A096NTE9_BMF-01       GVDPRYKNARRSVRKLKASSFLSCQPE----
                                                       

© 1998-2020Legal notice