Dataset for protein classical BH3-containing proteins of organism Papio anubis

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A096MPU8_PMAIP1-      ---------------------------------MPGKKARKNAQPSPTRA
A0A096N944_HRK-01       -------------------------------------MCPCPLHRGRGPP
A0A096MPU8_PMAIP1-      ----------------------------MPGKKARKNAQPSPTRAQAGQA
A0A096NTE9_BMF-03       ----------------------------MEPSRCVEELEDDVFQPEDGEP
A0A2I3N2Z9_BBC3-03      IKFGVGSARACPCQVPRASSATWVPCQICGPQPSLLLAEQHLESPVPSAP
A0A096NTE9_BMF-01       ----------------------------MEPSRCVEELEDDVFQPEDGEP
A0A096MLD5_BAD-02       ---------------------MFQIPEFEPSEQEDSSSAERGLGP--SPA
A0A096MLD5_BAD-01       ---------------------MFQIPEFEPSEQEDSSSAERGLGP--SPA
A0A096NKG5_BIK-01       ---------------------MSGVRPISRDILMETLLYEQLLEP-----
A0A096NYC3_BCL2L11      ------------------------MAKQPSDVSSECDREGRQLQPAERPP
A0A096NYC3_BCL2L11      ------------------------MAKQPSDVSSECDREGRQLQPAERPP
                                                                          

A0A096MPU8_PMAIP1-      QAELEVECATQLRRFGDKLNFRQKLLNLIAKLFCSGT-------------
A0A096N944_HRK-01       AVCACSAGRLGLRSSAAQLTAARLK-------------------------
A0A096MPU8_PMAIP1-      GTAGTARDQAGFGIGM-QLHFTRSKKLVSSSPLALPRG------------
A0A096NTE9_BMF-03       GAQPGSSLSADLFAQS-LLDCPLSRLQLFPLTHCCGPG------------
A0A2I3N2Z9_BBC3-03      GALAGGPTQA-------------------------APG------------
A0A096NTE9_BMF-01       GAQPGSSLSADLFAQS-LLDCPLSRLQLFPLTHCCGPG------------
A0A096MLD5_BAD-02       GDKPSDSGKHHRQAPGLLWDASHQQEQPTSSSHHGG---------RAWYS
A0A096MLD5_BAD-01       GDKPSDSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVETRSRHSSYP
A0A096NKG5_BIK-01       ---------LTMEVLG------------VTD-------------------
A0A096NYC3_BCL2L11      QLRPGAPTSLQTEPQG------------NPEGNHGGEG-------DSCPH
A0A096NYC3_BCL2L11      QLRPGAPTSLQTEPQG------------NPEGNHGGEG-------DSCPH
                                                                          

A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A096N944_HRK-01       ----------------------------------------ALGDELHQRT
A0A096MPU8_PMAIP1-      --HEEQVQVARSRVCYSTQE--------------------IWRQTELPAE
A0A096NTE9_BMF-03       --LRPTSQEDKATQTLGPAS--------------------PSQGVMLPCG
A0A2I3N2Z9_BBC3-03      --VR--GEEEQWAREIGAQL--------------------RRMADDLNAQ
A0A096NTE9_BMF-01       --LRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLP
A0A096MLD5_BAD-02       PSWESEDS--ENPSARMLAE--------------------------ASAP
A0A096MLD5_BAD-01       AGTEEDEGMEEEPSPFRGRS--------------------------RSAP
A0A096NKG5_BIK-01       --PEEDLDPMEDFDPLECME----------------------DSDMLALR
A0A096NYC3_BCL2L11      GSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAP
A0A096NYC3_BCL2L11      GSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAP
                                                                          

A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A096N944_HRK-01       MWRRRARSRRAPAPGALPTYWPWLCAAAQVAALAAWLLGRRNL-------
A0A096MPU8_PMAIP1-      TSESDSQTLLLRNLTASKTCIGGLQKRLFLRRCTLHQFEERLHCNW----
A0A096NTE9_BMF-03       VTEEPQRLFYAPAEPKSRVV---ADPPLPAQPCFEWRREQERGGP-----
A0A2I3N2Z9_BBC3-03      YERRRQEEQQRHRPSPWRVL---YNLIMGLLPLPRGHRAPEMEPN-----
A0A096NTE9_BMF-01       ASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRN
A0A096MLD5_BAD-02       MSAPATDSEAQHAENVKLKALGLWRRGVA---TAPTPRGRRRTKGWRRSP
A0A096MLD5_BAD-01       PNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVF
A0A096NKG5_BIK-01       LACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTDDIR--DVLRSFM
A0A096NYC3_BCL2L11      MSCDKSTQTPSPPCQAFNHYLS-AMASRRQAEPADMRPEIRIAQELRRIG
A0A096NYC3_BCL2L11      MSCDKSTQTPSPPCQAFNHYLS-AMASRRQAEPADMRPEIRIAQELRRIG
                                                                          

A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A096NTE9_BMF-03       --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A096NTE9_BMF-01       RVWWQILLFLHNLALNGEENRNGVDPRYKNARRSVRKLKASSFLSCQPE-
A0A096MLD5_BAD-02       APFGA---------------------ARAPRPPTSGQHSVMAASSGG---
A0A096MLD5_BAD-01       QSWWD---------------------RNLGRGSSAPSQ------------
A0A096NKG5_BIK-01       DGFTT---------------------LRENIMRFWRSPNPRSWVSREQVL
A0A096NYC3_BCL2L11      DEFNA---------------------Y------YARRLEK----------
A0A096NYC3_BCL2L11      DEFNA---------------------Y------YARRVFLNNYQAAEDHP
                                                                          

A0A096MPU8_PMAIP1-      -----------------------
A0A096N944_HRK-01       -----------------------
A0A096MPU8_PMAIP1-      -----------------------
A0A096NTE9_BMF-03       -----------------------
A0A2I3N2Z9_BBC3-03      -----------------------
A0A096NTE9_BMF-01       -----------------------
A0A096MLD5_BAD-02       -----------------------
A0A096MLD5_BAD-01       -----------------------
A0A096NKG5_BIK-01       LALLLLLALLLALLSGGLHLLLK
A0A096NYC3_BCL2L11      -----------------------
A0A096NYC3_BCL2L11      QMVILRLLRYIVRLVWRMH----
                                               

© 1998-2020Legal notice