Dataset for protein Bmf of organism Papio anubis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80

        90       100       110       120       130       140       150       160
*****************. *  .  : *. *         *  :*..                                 
                 an epklplp df avlpigeap cfe qhraevqiarklqciadqfhrlhvqqhqqnrnrvw

       170       180       190       200      
wqillflhnlalng ee g pdpryknarrsvrklkassflscqpe
© 1998-2020Legal notice