Dataset for protein Bmf of organism Papio anubis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
***********************************************************************     ..:*
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQt----srvW
                                                                       hqqnrnki 

       170       180       190       200  
....:....|....:....|....:....|....:....|..
 *    : . . :*::. *  .  * : ..::*:        
wQ---slhslglnGqenrNwmsprPstwsstvVnpp------
s illffgncach edgp gadil lslngal kcclsthvp
© 1998-2022Legal notice