Dataset for protein Bmf of organism Papio anubis

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A096NTE9_BMF-01      MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLF
A0A096NTE9_BMF-02      MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLF
                       **************************************************

A0A096NTE9_BMF-01      PLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNA
A0A096NTE9_BMF-02      PLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNA
                       **************************************************

A0A096NTE9_BMF-01      GYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQ
A0A096NTE9_BMF-02      GYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQ
                       **************************************************

A0A096NTE9_BMF-01      QHQQNRNRVWWQILLFLHNLALNGEENRNGADPRPLTWNGAVVKPC----
A0A096NTE9_BMF-02      QT----SKIWSQ---SFGSCGCHGQDGPNWMSILPSSLSSTLVNCPLSTH
                       *     ..:* *    : . . :*::. *  .  * : ..::*:      

A0A096NTE9_BMF-01      --
A0A096NTE9_BMF-02      VP
                         

© 1998-2022Legal notice