Dataset for protein Noxa of organism Panthera tigris altaica

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50    
....:....|....:....|....:....|....:....|....:....|....
                    **********************************
---xxxxxxxxxxxxxxxxxPEVECAMQLRRFGDKLNFRQKLMNLISKLFRSGT
xxxwcslsiktvkmspgrvp                                  
© 1998-2022Legal notice