Dataset for protein Noxa of organism Panthera tigris altaica

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C9J1B3_PMAIP1-      XXXXXXXXXXXXXXXXXXXXPEVECAMQLRRFGDKLNFRQKLMNLISKLF
A0A8C9J1B3_PMAIP1-      ---WCSLSIKTVKMSPGRVPPEVECAMQLRRFGDKLNFRQKLMNLISKLF
                                            ******************************

A0A8C9J1B3_PMAIP1-      RSGT
A0A8C9J1B3_PMAIP1-      RSGT
                        ****

© 1998-2022Legal notice