Dataset for protein Noxa of organism Panthera tigris altaica

[Download (right click)] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A8C9J1B3_PMAIP1-02      XXXXXXXXXXXXXXXXXXXXPEVECAMQLRRFGDKLNFRQKLMNLISKLF
A0A8C9J1B3_PMAIP1-01      WCS---LSIKTVKMSPGRVPPEVECAMQLRRFGDKLNFRQKLMNLISKLF
                                              ******************************

A0A8C9J1B3_PMAIP1-02      RSGT
A0A8C9J1B3_PMAIP1-01      RSGT
                          ****

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice