Dataset for protein Bim of organism Panthera leo

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80

        90       100       110       120       130       140       150       160

       170       180       190       200   
***                              ** .      
   rvflnnyqaaeaqpqmiilrllryivrliw  eqvpasyi
© 1998-2023Legal notice