Dataset for protein Bim of organism Panthera leo

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****************************************                                       
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQ---------------------------------------
                                         gnpegegdrcpqgspqgplappaspgpfatrsplfifvr
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                               *********************************
-----------------drspapmscdkstqtpsppcqafnhylsamASMRQPQAVPADMRPEIWIAQELRRIGDEFNAY
rssllsrsssgyfsfdt------------------------------                                 
                                                                                

       170       180       190       200   
....:....|....:....|....:....|....:....|...
***                              ** .      
YPR------------------------------RLqr------
   rvflnnyqaaeaqpqmiilrllryivrliw  eqvpasyi
                                   a       
© 1998-2022Legal notice