Dataset for protein Bim of organism Panthera leo

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C8Y6N0_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQ---------
A0A8C8Y6N0_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQ---------
A0A8C8Y6N0_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDR
A0A8C8Y6N0_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDR
                        *****************************************         

A0A8C8Y6N0_BCL2L11      --------------------------------------------------
A0A8C8Y6N0_BCL2L11      -----------------------------------------------DRS
A0A8C8Y6N0_BCL2L11      CPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
A0A8C8Y6N0_BCL2L11      CPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
                                                                          

A0A8C8Y6N0_BCL2L11      ---------------------------ASMRQPQAVPADMRPEIWIAQEL
A0A8C8Y6N0_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAVPADMRPEIWIAQEL
A0A8C8Y6N0_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAVPADMRPEIWIAQEL
A0A8C8Y6N0_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAVPADMRPEIWIAQEL
                                                   ***********************

A0A8C8Y6N0_BCL2L11      RRIGDEFNAYYPR------------------------------RLARVPA
A0A8C8Y6N0_BCL2L11      RRIGDEFNAYYPRRVFLNNYQAAEAQPQMIILRLLRYIVRLIWRLQR---
A0A8C8Y6N0_BCL2L11      RRIGDEFNAYYPR------------------------------RLEQ---
A0A8C8Y6N0_BCL2L11      RRIGDEFNAYYPRRVFLNNYQAAEAQPQMIILRLLRYIVRLIWRLQR---
                        *************                              ** .   

A0A8C8Y6N0_BCL2L11      SYI
A0A8C8Y6N0_BCL2L11      ---
A0A8C8Y6N0_BCL2L11      ---
A0A8C8Y6N0_BCL2L11      ---
                           

© 1998-2022Legal notice