Dataset for protein classical BH3-containing proteins of organism Pan troglodytes

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------------makqpsdvsse-----------------------
mararqegsspepveglardgprpfplgrlvpsavscglmkfgmgs--ac-cqepraylcsptwvpcvtcalggprwpga
                                       cep laaaqqiref----  aaa ap aqia         g
                                               fm- --lvei                       
                                               s-e tlcrdg                       
                                               pev ppsha                        
                                                 a                              
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------cdregrqlqpa---erppqlr-pga----------------------------------------------
satwvpcqi-----------pggqqesssaa---rrsaplparspldlpsvrrqlrprthcrprrprptsrelpltqtrs
prsrprgprpgppqpvasrtlaldgdlatqvhssllp d f qplgacglsllp falpg cgpglh aaqcdkarphlp
         lemreksgrln   aehgvrpgcapg                                             
           gdddkfpke   rl vpay   t                                              
           t  ah a p   lm tevh   g                                              
           l   a        d  l c   e                                              
           d                                                                    
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------ptslqtepqg------------------------------------------------------------
trspsrpvmsergwgpsqa-nppapgragdseelekssalalaggaapgvaraqrpggsggrshpggpgsprgggtvgpg
parhrqgggl-lavtsp-tqpge                                                         
          r---aggtpadry                                                         
           glt-e-a-saai                                                         
           c  r-d mrlfd                                                         
           q  er   ef                                                           
           a   q                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--g--g-----------------------------------------------------rspapmscdkstqtpsppcqa
dr-nh-gegdscphgspqgplappaspgpfatrsplfifmrrssllsrsssgyfsfdtd-------vedqrgrrl-wpdt
  sgsakhhrqarglvwdashqqeqptssshhggqvqshhstecrtqspprarkllqlgactrtvd-rqggsmqarvlvs
   valedeqwpqrilaalrtrgddlnpqyererrtsysrglpamqlgnqapldgasdsllsyllgtprdqh---qarpq
   pr arlgr aeagrvvermeapaaamlqldegeavapkwreihhqfalrkraqlseshqwepas-----vsve-agl
   aq y  pl  sfplg tisaq  e  wdf aeg    epq egglytd gm  g a  fvciwrqthvvnlrdr--f
                    dg    d  e    a      i   edeth  a         la hlamalrlgn lww-
                                             d  d                ee l hekfg ksn 
                                             a                    d a e eae   a 
                                                                  a   c   d     
                                                                      a         
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
fnhylsama-m----------r---p------------------------------------------------------
las----l-s-flslwrsgva-qae-admrpeiwiaqelrrigdefnayyarrvhlnnyqarsplpgsvtlrlqryivrl
rplagdl-cleacggt     tgevapgllanllygrsydnytrskpqsfgkllfkplrwwtpdharmwismrlssvwtr
y-cimgfvvtp          veprvvesgtiyrqttni lvshhhvdprttkgerlvssslewtsktsvqipwvlsgl 
-v-hwenrpww          sahtstateswqiwrll  dmla  tcmaeqaravipqrpakksfeqrspcnf cla  
qstfswwisvr          qtdsrrsrartkggfek   l    s g  l qssfmdfc fhqe gllh ea  g   
iqrlptrekrn          lrsqgnnawfsgf   g        m d  a nppefa     n  eh a a       
elq epq iql          iprp ll serde   d          a    mlnd           a           
 gp an  gni          gdmn g   chad                   kk                         
  k  h  ekf          e  l d    f                                                
  d      i           d  i      a                                                
                     a  h                                                       
                        a                                                       

       410         
....:....|....:....
                   
-------------------
vwrmhwlrnlsrgsslpsq
llqswldpl gg lhallk
 flal              
                   
                   
                   
                   
                   
                   
                   
                   
                   
© 1998-2022Legal notice