Dataset for protein classical BH3-containing proteins of organism Pan troglodytes

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------------makqpsdvsse-----------------------
mararqegsspepveglardgprpfplgrlvpsavscglmkfgmgs-----------ylcsptwvpcvtcaasatwvpcq
                                       cep laaaqac cqlpra  aaa ap aqia lggprw gs
                                               pme tpcveg                     ag
                                                 a  l ha                        
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------cdregrqlqpaerppqlr-pga-------------------------------------------------
icgprerhg---pmfvipefdqseveqsssglpsrppgaqssvlrplsrrqlfrptrphppgrrptsrphrptrtlsrps
ptwvprqprprt---sarlnapesptdvlas laadlf lglldc  ralpgcplrhccgaalclplqedka qrhrpag
arsr cgicltmgqpkfsklrghlgsprhlp                                                 
         eegddk---geslgiepea hy                                                 
           l agev -r  dglaat  e                                                 
           d  sa       a v c                                                    
              d          m                                                      
              a          c                                                      
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------ptslqtepqg---------------------------------------------------------g--g--
psqlvwlergvaps-a-npagdseelekssalalaggaapgvaraqrpggsggrshpggpgsprgggtvgpgde-nh-ge
g pgamgspaptggttqdg                                                      psgsakh
       -gq-gerq-pgr                                                      r valed
       tc-t---amsaa                                                      y pr ar
       r-l rsp  rpf                                                      i aq y 
        q  erd  el                                                       d      
        l   q    f                                                              
        a                                                                       
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------------------------rspapmscdkstqtpsppcqafnhylsam
gdscphgspqgplappaspgpfatrsplfifmrrssllsrsssgyfsfdtd-------vedqrgrrl-wpdtlas----l
hrqarglvwdashqqeqptssshhggqvqshhstecrtqspprarkllqlgactrtvd-rqggsmqarvlvsrplagdl-
eqwpqrilaalrtrgddlnpqyererrtsysrglpamqlgnqapldgasdsllsyllgtprdqh---qarpqy-cimgfv
lgr aeagrvvermeapaaamlqldegeavapkwreihhqfalrkraqlseshqwepas-----vsve-agl-v-hwenr
 pl  sfplg tisaq  e  wdf aeg    epq egglytd gm  g a  fvciwrqthvvnlrdr--fqstfswwi
            dg    d  e    a      i   edeth  a         la hlamalrlgn lww-iqrlptre
                                     d  d                ee l hekfg ksn elq epq 
                                     a                    d a e eae   a  gp an  
                                                          a   c   d       k  h  
                                                              a           d     
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
a-m----------r---p--------------------------------------------------------------
-s-flslwrsgva-qae-admrpeiwiaqelrrigdefnayyarrvhlnnyqarsplpgsvtlrlqryivrlvwrmhwlr
cleacggt     tgevapgllanllygrsydnytrskpqsfgkllfkplrwwtpdharmwismrlssvwtrllqswldp
vtp          veprvvesgtiyrqttni lvshhhvdprttkgerlvssslewtsktsvqipwvlsgl  flal   
pww          sahtstateswqiwrll  dmla  tcmaeqaravipqrpakksfeqrspcnf cla          
svr          qtdsrrsrartkggfek   l    s g  l qssfmdfc fhqe gllh ea  g           
krn          lrsqgnnawfsgf   g        m d  a nppefa     n  eh a a               
iql          iprp ll serde   d          a    mlnd           a                   
gni          gdmn g   chad                   kk                                 
ekf          e  l d    f                                                        
 i           d  i      a                                                        
             a  h                                                               
                a                                                               

       410 
....:....|.
           
-----------
nlsrgsslpsq
l gg lhallk
           
           
           
           
           
           
           
           
           
           
© 1998-2022Legal notice