Dataset for protein classical BH3-containing proteins of organism Pan troglodytes

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------ps-v-seledpgsqlrpaep-----------------ppqlr-psgpg-
mararqegsspmpvgmlsrqgprpqvpmaqv--q-s----rsvraeqglaqtllpaaylcaptappavvtapgglaa--k
           ekfeggaadacpcfplrfmqrefepeqqmmespkaelngr                 sspgds-l-stg
                           gskiatdcvcicdedqlypskgd                  tava-asgsad 
                            rle pwsrdgicgtlkshadr                   hlmspv -wrl 
                             es  l      c cfl                         eeac r  a 
                             a   a                                     c        
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------sle-epqgnpsgvrl---------g-el-s-pmdspagpsrrvqlpg
hhrqapgllwdqslqqeqltssslfplttscgpg-at---edapaqt-eeeqwlrel-g--r-r---lnrsyeqppmse-
prsrpr pvfaathldcppsrlqhhgpvhcysg-w-ptstsaketnhgrtaasakvivdsgdrmgklr-qq-legrhe-q
        rpgvpqssls dpqhdesgrp ap atrggqsq--aslqvqlttrkprfsaqesgcahg-slav-aaaaasc
         l g dpe d aeme  deg      pqsrgh-lr-eamqlfdrq  l  sacnqwtdwvr--rt-----an
                                    rmeg fgl mk  c  g  a   k lfqqlsa  rhpfqqpv d
                                    edda   i ge              i de a   pd  l  p  
                                    c      d  a              h a       a        
                                                             a                  

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-rttysplliyg-----l----s---------------l-----pap-gcr-s---------------------------
vvherpqwffs-ratsp-prsl-gylslfttlkenimr-irgrl---r---r-vqtpslrppcqalppysglhanwrqss
qlarplgrrvlynrsplvstvsrspfng          fgtslstlsmshdkrtmqqnglrlqtlfnhllsgmvsmpkrn
pf--e----cfmvqeartrvwalttyv           ydmdyq qqyvwqaprlekrf lralirsqteraltqqlfqe
g-vl-wtqw--attvykselprgprrt           wwlrpn pewtsmwqeevela k  cfhqlfh q splhaac
skphs k erwrq gldicdgedfiqg            piknf gapqkehgl lai       adfe    hlid   
aanci   a i p  eaaaaa  dhme            l  e    kcfagaa                   ca a   
  m a     a d           fkd                    gaa e                            
  l         a            a                     f                                

       250       260       270 
....:....|....:....|....:....|.
                               
-------------------------------
vnrvwwqiwlfqhnrrlngefnryyarrrek
qgdmrpe lialellaigd e ang gpl  
pa                             
g                              
                               
                               
                               
                               
© 1998-2020Legal notice