Dataset for protein classical BH3-containing proteins of organism Pan troglodytes

[Download (right click)] [Edit] [Sequences] [Repertoires]

24 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2I3RGH5_BBC3-04      --------------------------------------------------
A0A2I3RGH5_BBC3-02      --------------------------------------------------
H2Q6Y8_HRK-01           --------------------------------------------------
H2QLU7_BIK-01           --------------------------------------------------
A0A2I3TBK7_BAD-02       --------------------------------------------------
A0A2I3TBK7_BAD-03       --------------------------------------------------
A0A2I3TBK7_BAD-01       --------------------------------------------------
A0A2I3RGH5_BBC3-05      --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2I3RGH5_BBC3-01      MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAA
A0A2J8QDD5_BMF-02       --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
                                                                          

A0A2I3SX38_PMAIP1-      ---------------------------------------MPGKK--ARKN
A0A2I3RGH5_BBC3-04      ------------MKFGMGSAQACPCQVPRAASATWVPCQICGPR--ERHG
A0A2I3RGH5_BBC3-02      ------------MKFGMGSAQACPCQVPRAASATWVPCQICGPR--ERHG
H2Q6Y8_HRK-01           ----------------------MCPCPLHRGRDPPAVCACSAGRLGLRSS
H2QLU7_BIK-01           -------------------------------------------MSEVRPL
A0A2I3TBK7_BAD-02       -------------------------------------------MFQIPEF
A0A2I3TBK7_BAD-03       -------------------------------------------MFQIPEF
A0A2I3TBK7_BAD-01       -------------------------------------------MFQIPEF
A0A2I3RGH5_BBC3-05      ------------MKFGMGSAQACPCQVPRAASATWVPCQICETR--GAAA
A0A2J8QDD5_BMF-01       --------------------------------MEPSQCVEELEDDVFQPE
A0A2I3RGH5_BBC3-01      PTLLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSLA
A0A2J8QDD5_BMF-02       --------------------------------MEPSQCVEELEDDVFQPE
A0A2I3RGH5_BBC3-03      ------------MKFGMGSAQACPCQVPRAASATWVPCQICGPQPSLSLA
A0A2I3SX38_PMAIP1-      ---------------------------------------MPGKK--ARKN
A0A2I3S5F6_BCL2L11      --------------------------MAKQPSDVSSECDREGRQ--LQPA
A0A2I3S5F6_BCL2L11      --------------------------MAKQPSDVSSECDREGRQ--LQPA
A0A2I3S5F6_BCL2L11      --------------------------MAKQPSDVSSECDREGRQ--LQPA
A0A2I3S5F6_BCL2L11      --------------------------MAKQPSDVSSECDREGRQ--LQPA
A0A2I3S5F6_BCL2L11      --------------------------MAKQPSDVSSECDREGRQ--LQPA
A0A2I3S5F6_BCL2L11      --------------------------MAKQPSDVSSECDREGRQ--LQPA
A0A2I3S5F6_BCL2L11      --------------------------MAKQPSDVSSECDREGRQ--LQPA
A0A2I3S5F6_BCL2L11      --------------------------MAKQPSDVSSECDREGRQ--LQPA
A0A2I3S5F6_BCL2L11      --------------------------MAKQPSDVSSECDREGRQ--LQPA
A0A2I3S5F6_BCL2L11      --------------------------MAKQPSDVSSECDREGRQ--LQPA
                                                                          

A0A2I3SX38_PMAIP1-      AQPSPARAPAE---------------------------------------
A0A2I3RGH5_BBC3-04      PRTPGGQLPGA---------------------------------------
A0A2I3RGH5_BBC3-02      PRTPGGQLPGA---------------------------------------
H2Q6Y8_HRK-01           AAQLTAARLKA---------------------------------------
H2QLU7_BIK-01           SRDILMETLLY---------------------------------------
A0A2I3TBK7_BAD-02       EPSEQEDSSSA---------------------------------------
A0A2I3TBK7_BAD-03       EPSEQEDSSSA---------------------------------------
A0A2I3TBK7_BAD-01       EPSEQEDSSSA---------------------------------------
A0A2I3RGH5_BBC3-05      APPLALEGPVQSHHG-----------------------------------
A0A2J8QDD5_BMF-01       DGEPVTQ-PGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQED
A0A2I3RGH5_BBC3-01      EQHLESPVPSA---------------------------------------
A0A2J8QDD5_BMF-02       DGEPVTQ-PGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQED
A0A2I3RGH5_BBC3-03      EQHLESPVPSA---------------------------------------
A0A2I3SX38_PMAIP1-      AQPSPARAPAG---------------------------------------
A0A2I3S5F6_BCL2L11      ERPPQLR-PGA---------------------------------------
A0A2I3S5F6_BCL2L11      ERPPQLR-PGA---------------------------------------
A0A2I3S5F6_BCL2L11      ERPPQLR-PGA---------------------------------------
A0A2I3S5F6_BCL2L11      ERPPQLR-PGA---------------------------------------
A0A2I3S5F6_BCL2L11      ERPPQLR-PGA---------------------------------------
A0A2I3S5F6_BCL2L11      ERPPQLR-PGA---------------------------------------
A0A2I3S5F6_BCL2L11      ERPPQLR-PGA---------------------------------------
A0A2I3S5F6_BCL2L11      ERPPQLR-PGA---------------------------------------
A0A2I3S5F6_BCL2L11      ERPPQLR-PGA---------------------------------------
A0A2I3S5F6_BCL2L11      ERPPQLR-PGA---------------------------------------
                                                                          

A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2I3RGH5_BBC3-04      ---------RRGPGPRRPAPLPARPPGALGSVLRPLRARPGCRPRRPHPA
A0A2I3RGH5_BBC3-02      ---------RRGPGPRRPAPLPARPPGALGSVLRPLRARPGCRPRRPHPA
H2Q6Y8_HRK-01           --------------------------------------------------
H2QLU7_BIK-01           -----------------EQLLEPPTME-----------------------
A0A2I3TBK7_BAD-02       -----------------ERGLGPSPAGD----------------------
A0A2I3TBK7_BAD-03       -----------------ERGLGPSPAGD----------------------
A0A2I3TBK7_BAD-01       -----------------ERGLGPSPAGD----------------------
A0A2I3RGH5_BBC3-05      -----------------TPALTQGPQSP----------------------
A0A2J8QDD5_BMF-01       KATQTLSPASPSQGVMLPCGVTEEPQ------------------------
A0A2I3RGH5_BBC3-01      -----------------PGALAGGPTQA----------------------
A0A2J8QDD5_BMF-02       KATQTLSPASPSQGVMLPCGVTEEPQRL----------------------
A0A2I3RGH5_BBC3-03      -----------------PGALAGGPTQA----------------------
A0A2I3SX38_PMAIP1-      -----------------PAGTARDQAGF----------------------
A0A2I3S5F6_BCL2L11      -----------------PTSLQTEPQ------------------------
A0A2I3S5F6_BCL2L11      -----------------PTSLQTEPQ------------------------
A0A2I3S5F6_BCL2L11      -----------------PTSLQTEPQGN----------------------
A0A2I3S5F6_BCL2L11      -----------------PTSLQTEPQGN----------------------
A0A2I3S5F6_BCL2L11      -----------------PTSLQTEPQGN----------------------
A0A2I3S5F6_BCL2L11      -----------------PTSLQTEPQGN----------------------
A0A2I3S5F6_BCL2L11      -----------------PTSLQTEPQGN----------------------
A0A2I3S5F6_BCL2L11      -----------------PTSLQTEPQGN----------------------
A0A2I3S5F6_BCL2L11      -----------------PTSLQTEPQ------------------------
A0A2I3S5F6_BCL2L11      -----------------PTSLQTEPQ------------------------
                                                                          

A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2I3RGH5_BBC3-04      ARCLPLRPHRPTRRHRRPGGSPLAWGSPQPAPRPAPGRAGDSEELEKSSA
A0A2I3RGH5_BBC3-02      ARCLPLRPHRPTRRHRRPGGSPLAWGSPQPAPRPAPGR---------SSA
H2Q6Y8_HRK-01           --------------------------------------------------
H2QLU7_BIK-01           --------------------------------------------------
A0A2I3TBK7_BAD-02       --------------------------------------------------
A0A2I3TBK7_BAD-03       --------------------------------------------------
A0A2I3TBK7_BAD-01       --------------------------------------------------
A0A2I3RGH5_BBC3-05      --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2I3RGH5_BBC3-01      --------------------------------------------------
A0A2J8QDD5_BMF-02       --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
                                                                          

A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2I3RGH5_BBC3-04      LALAGGAAPGVARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPAAADG
A0A2I3RGH5_BBC3-02      LALAGGAAPGVARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPAAADG
H2Q6Y8_HRK-01           --------------------------------------------------
H2QLU7_BIK-01           --------------------------------------------------
A0A2I3TBK7_BAD-02       -----------------------------------------GPSGSGKHH
A0A2I3TBK7_BAD-03       -----------------------------------------GPSGSGKHH
A0A2I3TBK7_BAD-01       -----------------------------------------GPSGSGKHH
A0A2I3RGH5_BBC3-05      -----------------------------------------RDGAQLG--
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2I3RGH5_BBC3-01      -----------------------------------------APGVRGEEE
A0A2J8QDD5_BMF-02       -----------------------------------------FYGNAGYRL
A0A2I3RGH5_BBC3-03      -----------------------------------------APGVRGEEE
A0A2I3SX38_PMAIP1-      -----------------------------------------GIG------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      -----------------------------------------PEGNHGGEG
A0A2I3S5F6_BCL2L11      -----------------------------------------PEGNHGGEG
A0A2I3S5F6_BCL2L11      -----------------------------------------PEGNHGGEG
A0A2I3S5F6_BCL2L11      -----------------------------------------PEGNHGGEG
A0A2I3S5F6_BCL2L11      -----------------------------------------PEGNHGGEG
A0A2I3S5F6_BCL2L11      -----------------------------------------PEGNHGGEG
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
                                                                          

A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2I3RGH5_BBC3-04      GRPQRAVRAAETRGAAAAPPLALEGPVQSHHGTPALTQGPQSPRDGAQLG
A0A2I3RGH5_BBC3-02      GRPQRAVRAAETRGAAAAPPLALEGPVQSHHGTPALTQGPQSPRDGAQLG
H2Q6Y8_HRK-01           ----------------------------------------------LGDE
H2QLU7_BIK-01           ------VLGVTDSEEDLDPMEDFD-------SLECMEGSDALALRL----
A0A2I3TBK7_BAD-02       RQAPGLLWDASHQQEQPTSSSHHGGAGAV--EIRSRHSSYPAG-------
A0A2I3TBK7_BAD-03       RQAPGLLWDASHQQEQPTSSSHHGGRTSYSPSWESEDSENPSAGML----
A0A2I3TBK7_BAD-01       RQAPGLLWDASHQQEQPTSSSHHGEGTS---SPEERGHSNPDAAKLQLDA
A0A2I3RGH5_BBC3-05      --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2I3RGH5_BBC3-01      QWAREIGAQLRRMADDLNAQYERRRQE-----------------------
A0A2J8QDD5_BMF-02       PLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHR--------
A0A2I3RGH5_BBC3-03      QWAREIGAQLRRMADDLNAQYERRRQE-----------------------
A0A2I3SX38_PMAIP1-      -----------------------------------MQLRFTRGKKLLSSS
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      -------------------------------------------------D
A0A2I3S5F6_BCL2L11      DSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD
A0A2I3S5F6_BCL2L11      DSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD
A0A2I3S5F6_BCL2L11      DSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD
A0A2I3S5F6_BCL2L11      DSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD
A0A2I3S5F6_BCL2L11      DSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD
A0A2I3S5F6_BCL2L11      DSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD
A0A2I3S5F6_BCL2L11      -------------------------------------------------D
A0A2I3S5F6_BCL2L11      -------------------------------------------------D
                                                                          

A0A2I3SX38_PMAIP1-      ---LEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT-------------
A0A2I3RGH5_BBC3-04      ACTRPVDVRDSGGRPLPPPDTLASAGDFLCTM------------------
A0A2I3RGH5_BBC3-02      ACTRPVDVRDSGGRPLPPPDTLASAGDFLCTM------------------
H2Q6Y8_HRK-01           LHQRTMWRRRARSRRAPAPGALPTYWPWLC------------AAAQVAAL
H2QLU7_BIK-01           ---ACIGDEMDVSLRAPRLAQLSD------------------VAMHSLGL
A0A2I3TBK7_BAD-02       -------TEDDEGMGEEPSPFRGR------------------SRSAPPNL
A0A2I3TBK7_BAD-03       -------AEASAGMSAPAADSEAQHAENVKLEALGLWRSGVATAPTPRGR
A0A2I3TBK7_BAD-01       SLPVLVGSELGQGKLRPLPVTFAPHPE---------------TPPVPTAL
A0A2I3RGH5_BBC3-05      ACTRPVDVRDSGGRPLPPPDTLASAGDFLCTM------------------
A0A2J8QDD5_BMF-01       RLFYAPAEPKSCVVADPPLPAQPCFEWRREQE----------RGRP----
A0A2I3RGH5_BBC3-01      --------EQQRHRPSPWRVLYNLIMGLLPLP----------RGHRAPEM
A0A2J8QDD5_BMF-02       -----LHVQQHQQNQNRVWWQILLFLHNLALN----------GEENRNGA
A0A2I3RGH5_BBC3-03      --------EQQRHRPSPWRVLYNLIMGLLPLP----------RGHRAPEM
A0A2I3SX38_PMAIP1-      LSSWPLALPRGHEEQVQVAGSRVCYSTQEIWR----------QTELPAET
A0A2I3S5F6_BCL2L11      -----------------------------ASM----------RQAEPADM
A0A2I3S5F6_BCL2L11      RSPAPMSCDKSTQTPSPPCQAFNHYLSAMASM----------RQAEPADM
A0A2I3S5F6_BCL2L11      RSPAPMSCDKSTQTPSPPCQAFNHYLSAMVRE----------IEEVVV--
A0A2I3S5F6_BCL2L11      RSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIF----------E-------
A0A2I3S5F6_BCL2L11      RSPAPMSCDKSTQTPSPPCQAFNHYLSAMANW----------D-------
A0A2I3S5F6_BCL2L11      RSPAPMSCDKSTQTPSPPCQAFNHYLSAMASM----------RQAEPADM
A0A2I3S5F6_BCL2L11      RSPAPMSCDKSTQTPSPPCQAFNHYLSAMASM----------RQAEPADM
A0A2I3S5F6_BCL2L11      RSPAPMSCDKSTQTPSPPCQAFNHYLSAMASM----------RQAEPADM
A0A2I3S5F6_BCL2L11      RSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVI----------LEDIGDLS
A0A2I3S5F6_BCL2L11      RSPAPMSCDKSTQTPSPPCQAFNHYLSAM--------------DDSAGSS
                                                                          

A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2I3RGH5_BBC3-04      --------------------------------------------------
A0A2I3RGH5_BBC3-02      --------------------------------------------------
H2Q6Y8_HRK-01           AAWLLGRRNL----------------------------------------
H2QLU7_BIK-01           AFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSREQVLLAL
A0A2I3TBK7_BAD-02       WAAQRYGRELRRMSDEFVDSF-KKGLP-----RPKSAGTATQMRQSSSWT
A0A2I3TBK7_BAD-03       RTTKGWGRS--------PAPFGAARAR-----RPPTSGQHSAMAASSGG-
A0A2I3TBK7_BAD-01       GSHLEYGRKY------FPQAYAKRGSV-----LSPLEGGLTPIPFRCV--
A0A2I3RGH5_BBC3-05      --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2I3RGH5_BBC3-01      EPN-----------------------------------------------
A0A2J8QDD5_BMF-02       GPR-----------------------------------------------
A0A2I3RGH5_BBC3-03      EPN-----------------------------------------------
A0A2I3SX38_PMAIP1-      SESDIQTLLLRNLTASKTCMRGLLQKSFLRRCTFHQFEERLHCNW-----
A0A2I3S5F6_BCL2L11      RPEIWIAQELRRIGDEFNAYYARRLAKLLASST-----------------
A0A2I3S5F6_BCL2L11      RPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVR
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      RPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVR
A0A2I3S5F6_BCL2L11      RPEIWIAQELRRIGDEFNAYYARRLEK-----------------------
A0A2I3S5F6_BCL2L11      RPEIWIAQELRRIGDEFNAYYARRMPLPPD--------------------
A0A2I3S5F6_BCL2L11      LCFGFIFTGLDLYGHHHSQDAEQLNHKDFS--------------------
A0A2I3S5F6_BCL2L11      LRIAL--------------------HREVQWPLKWLAKSS----------
                                                                          

A0A2I3SX38_PMAIP1-      --------------------
A0A2I3RGH5_BBC3-04      --------------------
A0A2I3RGH5_BBC3-02      --------------------
H2Q6Y8_HRK-01           --------------------
H2QLU7_BIK-01           LLLLALLLPLLSGGLHLLLK
A0A2I3TBK7_BAD-02       RVFQSWWDRNLGRGSSAPSQ
A0A2I3TBK7_BAD-03       --------------------
A0A2I3TBK7_BAD-01       --------------------
A0A2I3RGH5_BBC3-05      --------------------
A0A2J8QDD5_BMF-01       --------------------
A0A2I3RGH5_BBC3-01      --------------------
A0A2J8QDD5_BMF-02       --------------------
A0A2I3RGH5_BBC3-03      --------------------
A0A2I3SX38_PMAIP1-      --------------------
A0A2I3S5F6_BCL2L11      --------------------
A0A2I3S5F6_BCL2L11      LVWRMH--------------
A0A2I3S5F6_BCL2L11      --------------------
A0A2I3S5F6_BCL2L11      --------------------
A0A2I3S5F6_BCL2L11      --------------------
A0A2I3S5F6_BCL2L11      LVWRMH--------------
A0A2I3S5F6_BCL2L11      --------------------
A0A2I3S5F6_BCL2L11      --------------------
A0A2I3S5F6_BCL2L11      --------------------
A0A2I3S5F6_BCL2L11      --------------------
                                            

© 1998-2021Legal notice