Dataset for protein classical BH3-containing proteins of organism Pan troglodytes

[Download (right click)] [Edit] [Sequences] [Repertoires]

12 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3RGH5_BBC3-01      MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAA
A0A2J8QDD5_BMF-01       -----------------------------MEPSQCVEELEDDVFQPEDGE
A0A2J8QDD5_BMF-02       -----------------------------MEPSQCVEELEDDVFQPEDGE
H2QLU7_BIK-01           ---------------------------MSEVRPLSRDILMETLLYEQLLE
A0A2I3TBK7_BAD-03       ---------------------------MFQIPEFEPSEQEDSSSAERGLG
A0A2I3TBK7_BAD-01       ---------------------------MFQIPEFEPSEQEDSSSAERGLG
A0A2I3RGH5_BBC3-03      -----------MKFGMGSAQACPCQVPRAASATWVPCQICGPQPSLSLAE
A0A2I3SX38_PMAIP1-      ----------------------------------------MPGKKARKNA
A0A2I3SN61_BCL2L11      ---------------------------MAKQPSDVSSECDREGRQLQPAE
A0A2I3SN61_BCL2L11      ---------------------------MAKQPSDVSSECDREGRQLQPAE
A0A2I3SX38_PMAIP1-      ----------------------------------------MPGKKARKNA
H2Q6Y8_HRK-01           ---------------------------------------MCPCPLHRGRD
                                                                          

A0A2I3RGH5_BBC3-01      PTLLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSLA
A0A2J8QDD5_BMF-01       P-----------------VTQPGSLLSAD---------LFAQSLLDCPLS
A0A2J8QDD5_BMF-02       P-----------------VTQPGSLLSAD---------LFAQSLLDCPLS
H2QLU7_BIK-01           P-----------------PTME----------------VLGVTDSEEDLD
A0A2I3TBK7_BAD-03       P-----------------SPAGDGPSGSGKHHRQAPGLLWDASHQQEQPT
A0A2I3TBK7_BAD-01       P-----------------SPAGDGPSGSGKHHRQAPGLLWDASHQQEQPT
A0A2I3RGH5_BBC3-03      Q-----------------HLESPVPSAPG---------------------
A0A2I3SX38_PMAIP1-      Q-----------------PSPARAPAGPA---------------------
A0A2I3SN61_BCL2L11      R-----------------PPQLR-PGAPT---------------------
A0A2I3SN61_BCL2L11      R-----------------PPQLR-PGAPT---------------------
A0A2I3SX38_PMAIP1-      Q-----------------PSPARAPA------------------------
H2Q6Y8_HRK-01           P-----------------PAVCACSAGRL---------------------
                                                                          

A0A2I3RGH5_BBC3-01      EQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNA
A0A2J8QDD5_BMF-01       RLQLFPLTHCCGPGLRPTSQEDKATQTL-------------------SPA
A0A2J8QDD5_BMF-02       RLQLFPLTHCCGPGLRPTSQEDKATQTL-------------------SPA
H2QLU7_BIK-01           PMEDFD-------SLECMEGSDALALRL-----------ACIGDEMDVSL
A0A2I3TBK7_BAD-03       SSSHHGGRTSYSPSWESEDSENPSAGML-----------AEASAGMSAPA
A0A2I3TBK7_BAD-01       SSSHHGEGTS---SPEERGHSNPDAAKLQLDASLPVLVGSELGQGKLRPL
A0A2I3RGH5_BBC3-03      -------------ALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNA
A0A2I3SX38_PMAIP1-      -------------GTARDQAGFGIGMQLRFTRGKKLLSSSLSSWPLALPR
A0A2I3SN61_BCL2L11      -------------SLQTEPQGNPEGNH----------GGEGDSCPHGSPQ
A0A2I3SN61_BCL2L11      -------------SLQTEPQGNPEGNH----------GGEGDSCPHGSPQ
A0A2I3SX38_PMAIP1-      ------------------------ELEVECATQLRRFGDKLNFRQKL---
H2Q6Y8_HRK-01           --------------------GLRSSAAQLTAARLKALGDELHQRTMWRRR
                                                                          

A0A2I3RGH5_BBC3-01      QYERRRQEEQQRHRPSPWRVLYN-------------------------LI
A0A2J8QDD5_BMF-01       SPSQGVMLPCGVTEEPQRLFYAPAEPKSCVVADPPL--------------
A0A2J8QDD5_BMF-02       SPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAV-----------LP
H2QLU7_BIK-01           RAPRLAQLSDVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFW
A0A2I3TBK7_BAD-03       ADSEAQHAENVKLEALGLWRSGVATAPTPRGRRTTKG-----------WG
A0A2I3TBK7_BAD-01       PVTFAPHPE---------------TPPVPTALGSHLE-----------YG
A0A2I3RGH5_BBC3-03      QYERRRQEEQQRHRPSPWRVL--------------YN-----------LI
A0A2I3SX38_PMAIP1-      GHEEQVQVAGSRVCYSTQEIWRQTELPAETSESDIQT-----------LL
A0A2I3SN61_BCL2L11      GPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFS-----------FD
A0A2I3SN61_BCL2L11      GPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFS-----------FD
A0A2I3SX38_PMAIP1-      -----------LNLISKLFCSGT---------------------------
H2Q6Y8_HRK-01           ARSRRAPAPGALPTYWPWLCAAAQVAALAAWLLGRRNL------------
                                                                          

A0A2I3RGH5_BBC3-01      MGLLPLPRGHRAPEMEPN--------------------------------
A0A2J8QDD5_BMF-01       ----PAQPCFEWRREQERGRP-----------------------------
A0A2J8QDD5_BMF-02       IGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILL
H2QLU7_BIK-01           RSPNPGSWVSREQVLLALLLLLALLLPLLSGGLHLLLK------------
A0A2I3TBK7_BAD-03       RS--PAPFGAARAR-----------RPPTSGQHSAMAASSGG--------
A0A2I3TBK7_BAD-01       RKYFPQAYAKRGSV-----------LSPLEGGLTPIPFRCV---------
A0A2I3RGH5_BBC3-03      MGLLPLPRGHRAPEMEPN--------------------------------
A0A2I3SX38_PMAIP1-      LRNLTASKTCMRGLLQKSFLRRCTFHQFEERLHCNW--------------
A0A2I3SN61_BCL2L11      TDRSPAPMSCDKSTQTPS--PPCQAFNHYLSAMASMRQAEPADMRPEIWI
A0A2I3SN61_BCL2L11      TDRSPAPMSCDKSTQTPS--PPCQAFNHYLSAMANWD-------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2Q6Y8_HRK-01           --------------------------------------------------
                                                                          

A0A2I3RGH5_BBC3-01      ---------------------
A0A2J8QDD5_BMF-01       ---------------------
A0A2J8QDD5_BMF-02       FLHNLALNGEENRNGAGPR--
H2QLU7_BIK-01           ---------------------
A0A2I3TBK7_BAD-03       ---------------------
A0A2I3TBK7_BAD-01       ---------------------
A0A2I3RGH5_BBC3-03      ---------------------
A0A2I3SX38_PMAIP1-      ---------------------
A0A2I3SN61_BCL2L11      AQELRRIGDEFNAYYARRLEK
A0A2I3SN61_BCL2L11      ---------------------
A0A2I3SX38_PMAIP1-      ---------------------
H2Q6Y8_HRK-01           ---------------------
                                             

© 1998-2020Legal notice