Dataset for protein classical BH3-containing proteins of organism Pan troglodytes

[Download (right click)] [Edit] [Sequences] [Repertoires]

24 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2I3RGH5_BBC3-02      --------------------------------------------------
A0A2I3RGH5_BBC3-04      --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2J8QDD5_BMF-02       --------------------------------------------------
H2Q6Y8_HRK-01           --------------------------------------------------
H2QLU7_BIK-01           --------------------------------------------------
A0A2I3TBK7_BAD-01       --------------------------------------------------
A0A2I3TBK7_BAD-03       --------------------------------------------------
A0A2I3TBK7_BAD-02       --------------------------------------------------
A0A2I3RGH5_BBC3-05      --------------------------------------------------
A0A2I3RGH5_BBC3-01      MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAA
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
                                                                          

A0A2I3SX38_PMAIP1-      ---------------------------------------MPGKK------
A0A2I3RGH5_BBC3-02      ------------MKFGMGSAQACPCQVPRAASATWVPCQICGPRERHGPR
A0A2I3RGH5_BBC3-04      ------------MKFGMGSAQACPCQVPRAASATWVPCQICGPRERHGPR
A0A2J8QDD5_BMF-01       --------------------------------MEPSQCVEELEDD-----
A0A2J8QDD5_BMF-02       --------------------------------MEPSQCVEELEDD-----
H2Q6Y8_HRK-01           --------------------------------------------------
H2QLU7_BIK-01           -----------------------MSEVRPLSRDILMETLLYEQL------
A0A2I3TBK7_BAD-01       -----------------------MFQIPEFEPSEQEDSSSAERG------
A0A2I3TBK7_BAD-03       -----------------------MFQIPEFEPSEQEDSSSAERG------
A0A2I3TBK7_BAD-02       -----------------------MFQIPEFEPSEQEDSSSAERG------
A0A2I3RGH5_BBC3-05      ------------MKFGMGSAQACPCQVPRAASATWVPCQICETR------
A0A2I3RGH5_BBC3-01      PTLLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQP-----
A0A2I3RGH5_BBC3-03      ------------MKFGMGSAQACPCQVPRAASATWVPCQICGPQP-----
A0A2I3SX38_PMAIP1-      ---------------------------------------MPGKK------
A0A2I3SN61_BCL2L11      --------------------------MAKQPSDVSSECDREGRQ------
A0A2I3SN61_BCL2L11      --------------------------MAKQPSDVSSECDREGRQ------
A0A2I3SN61_BCL2L11      --------------------------MAKQPSDVSSECDREGRQ------
A0A2I3SN61_BCL2L11      --------------------------MAKQPSDVSSECDREGRQ------
A0A2I3SN61_BCL2L11      --------------------------MAKQPSDVSSECDREGRQ------
A0A2I3SN61_BCL2L11      --------------------------MAKQPSDVSSECDREGRQ------
A0A2I3SN61_BCL2L11      --------------------------MAKQPSDVSSECDREGRQ------
A0A2I3SN61_BCL2L11      --------------------------MAKQPSDVSSECDREGRQ------
A0A2I3SN61_BCL2L11      --------------------------MAKQPSDVSSECDREGRQ------
A0A2I3SN61_BCL2L11      --------------------------MAKQPSDVSSECDREGRQ------
                                                                          

A0A2I3SX38_PMAIP1-      --------------------------------ARKNAQPSPARAP-----
A0A2I3RGH5_BBC3-02      TPGGQLPGARRGPGPRRPAPLPARPPGALGSVLRPLRARPGCR-PRRPHP
A0A2I3RGH5_BBC3-04      TPGGQLPGARRGPGPRRPAPLPARPPGALGSVLRPLRARPGCR-PRRPHP
A0A2J8QDD5_BMF-01       -------------------------------VFQPEDGEPVTQ-PGSLLS
A0A2J8QDD5_BMF-02       -------------------------------VFQPEDGEPVTQ-PGSLLS
H2Q6Y8_HRK-01           -------------------------------------------------M
H2QLU7_BIK-01           -------------------------------------------------L
A0A2I3TBK7_BAD-01       -------------------------------------------------L
A0A2I3TBK7_BAD-03       -------------------------------------------------L
A0A2I3TBK7_BAD-02       -------------------------------------------------L
A0A2I3RGH5_BBC3-05      --------------------------------GAAAAPPLALEGPVQSHH
A0A2I3RGH5_BBC3-01      -------------------------------SLSLAEQHLESPVP----S
A0A2I3RGH5_BBC3-03      -------------------------------SLSLAEQHLESPVP----S
A0A2I3SX38_PMAIP1-      --------------------------------ARKNAQPSPARAP----A
A0A2I3SN61_BCL2L11      --------------------------------LQPAERPPQLR-P----G
A0A2I3SN61_BCL2L11      --------------------------------LQPAERPPQLR-P----G
A0A2I3SN61_BCL2L11      --------------------------------LQPAERPPQLR-P----G
A0A2I3SN61_BCL2L11      --------------------------------LQPAERPPQLR-P----G
A0A2I3SN61_BCL2L11      --------------------------------LQPAERPPQLR-P----G
A0A2I3SN61_BCL2L11      --------------------------------LQPAERPPQLR-P----G
A0A2I3SN61_BCL2L11      --------------------------------LQPAERPPQLR-P----G
A0A2I3SN61_BCL2L11      --------------------------------LQPAERPPQLR-P----G
A0A2I3SN61_BCL2L11      --------------------------------LQPAERPPQLR-P----G
A0A2I3SN61_BCL2L11      --------------------------------LQPAERPPQLR-P----G
                                                                          

A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2I3RGH5_BBC3-02      AARCLPLRPHRPTRRHRRPGGSPLAWGSPQPAPRPAPGR---------SS
A0A2I3RGH5_BBC3-04      AARCLPLRPHRPTRRHRRPGGSPLAWGSPQPAPRPAPGRAGDSEELEKSS
A0A2J8QDD5_BMF-01       ADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKAT-----------
A0A2J8QDD5_BMF-02       ADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKAT-----------
H2Q6Y8_HRK-01           CPCPLHRGRDPPAVCACSAGRLGLRSSAAQLTAARLKAL-----------
H2QLU7_BIK-01           EPPTME----------------VLGVTDSEEDLDPMEDF-----------
A0A2I3TBK7_BAD-01       GPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHH-----------
A0A2I3TBK7_BAD-03       GPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHH-----------
A0A2I3TBK7_BAD-02       GPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHH-----------
A0A2I3RGH5_BBC3-05      GTPALTQGPQSPRDGAQLGA------------------------------
A0A2I3RGH5_BBC3-01      APGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLN-----------
A0A2I3RGH5_BBC3-03      APGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLN-----------
A0A2I3SX38_PMAIP1-      GPAGTARDQAGFGIG-----------------------------------
A0A2I3SN61_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2I3SN61_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2I3SN61_BCL2L11      APTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASP-----------
A0A2I3SN61_BCL2L11      APTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASP-----------
A0A2I3SN61_BCL2L11      APTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASP-----------
A0A2I3SN61_BCL2L11      APTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASP-----------
A0A2I3SN61_BCL2L11      APTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASP-----------
A0A2I3SN61_BCL2L11      APTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASP-----------
A0A2I3SN61_BCL2L11      APTSLQTEPQ----------------------------------------
A0A2I3SN61_BCL2L11      APTSLQTEPQ----------------------------------------
                                                                          

A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2I3RGH5_BBC3-02      ALALAGGAAPGVARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPAAAD
A0A2I3RGH5_BBC3-04      ALALAGGAAPGVARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPAAAD
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2J8QDD5_BMF-02       --------------------------------------------------
H2Q6Y8_HRK-01           --------------------------------------------------
H2QLU7_BIK-01           --------------------------------------------------
A0A2I3TBK7_BAD-01       --------------------------------------------------
A0A2I3TBK7_BAD-03       --------------------------------------------------
A0A2I3TBK7_BAD-02       --------------------------------------------------
A0A2I3RGH5_BBC3-05      --------------------------------------------------
A0A2I3RGH5_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
                                                                          

A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2I3RGH5_BBC3-02      GGRPQRAVRAAETRGAAAAPPLALEGPVQSHHGTPALTQGPQSPRDGAQL
A0A2I3RGH5_BBC3-04      GGRPQRAVRAAETRGAAAAPPLALEGPVQSHHGTPALTQGPQSPRDGAQL
A0A2J8QDD5_BMF-01       -------------------QTLSPASPSQGVMLPCGVTEEPQRLFYAPAE
A0A2J8QDD5_BMF-02       -------------------QTLSPASPSQGVMLPCGVTEEPQRLFYGNAG
H2Q6Y8_HRK-01           -------------------GD-----------------------------
H2QLU7_BIK-01           -------------------DS-------------LECMEGSDALALRLAC
A0A2I3TBK7_BAD-01       -------------------GE--------------GTSSPEERGHSNPDA
A0A2I3TBK7_BAD-03       -------------------GG---------RTSYSPSWESED--SENPSA
A0A2I3TBK7_BAD-02       -------------------GGAGAVEIRSRHSSYPAGTEDDEGMGEEPSP
A0A2I3RGH5_BBC3-05      --------------------------------------------------
A0A2I3RGH5_BBC3-01      -------------------AQYERRRQE----------------------
A0A2I3RGH5_BBC3-03      -------------------AQYERRRQE----------------------
A0A2I3SX38_PMAIP1-      ------------------------------------MQLRFTRGKKLLSS
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      -------------------GPFATRSPLFIFMRRSSLLSRSSSGYFSFDT
A0A2I3SN61_BCL2L11      -------------------GPFATRSPLFIFMRRSSLLSRSSSGYFSFDT
A0A2I3SN61_BCL2L11      -------------------GPFATRSPLFIFMRRSSLLSRSSSGYFSFDT
A0A2I3SN61_BCL2L11      -------------------GPFATRSPLFIFMRRSSLLSRSSSGYFSFDT
A0A2I3SN61_BCL2L11      -------------------GPFATRSPLFIFMRRSSLLSRSSSGYFSFDT
A0A2I3SN61_BCL2L11      -------------------GPFATRSPLFIFMRRSSLLSRSSSGYFSFDT
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
                                                                          

A0A2I3SX38_PMAIP1-      --AELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT------------
A0A2I3RGH5_BBC3-02      GACTRPVDVRDSGGRPLPPPDTLASAGDFLCTM-----------------
A0A2I3RGH5_BBC3-04      GACTRPVDVRDSGGRPLPPPDTLASAGDFLCTM-----------------
A0A2J8QDD5_BMF-01       PKSCVVADPPL-------PAQPCFEWRREQERGRP---------------
A0A2J8QDD5_BMF-02       YRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQ
H2Q6Y8_HRK-01           ELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAA------------
H2QLU7_BIK-01           IGDEMDVSLRAPRLAQLSDVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTT
A0A2I3TBK7_BAD-01       AKLQLDASLPVLVGSELGQGKLRPLPVTF-------AP---HPETPPVPT
A0A2I3TBK7_BAD-03       GMLAEASAGMSAPAADSEAQHAENVKLEALGLWRSGVA------TAPTPR
A0A2I3TBK7_BAD-02       FRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLP---RPKSAGTAT
A0A2I3RGH5_BBC3-05      --CTRPVDVRDSGGRPLPPPDTLASAGDFLCTM-----------------
A0A2I3RGH5_BBC3-01      ---------EQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN------
A0A2I3RGH5_BBC3-03      ---------EQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN------
A0A2I3SX38_PMAIP1-      SLSSWPLALPRGHEEQVQVAGSRVCYSTQEIWRQTELPAETSESDIQTLL
A0A2I3SN61_BCL2L11      ------------------------------ASMRQAEPADMRPEIWIAQE
A0A2I3SN61_BCL2L11      DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQE
A0A2I3SN61_BCL2L11      DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV-----------
A0A2I3SN61_BCL2L11      DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE----------------
A0A2I3SN61_BCL2L11      DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD----------------
A0A2I3SN61_BCL2L11      DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQE
A0A2I3SN61_BCL2L11      DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQE
A0A2I3SN61_BCL2L11      DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQE
A0A2I3SN61_BCL2L11      DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGDLSLCFGFIFTG
A0A2I3SN61_BCL2L11      DRSPAPMSCDKSTQTPSPPCQAFNHYLSAM----DDSAGSSLRIAL----
                                                                          

A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2I3RGH5_BBC3-02      --------------------------------------------------
A0A2I3RGH5_BBC3-04      --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2J8QDD5_BMF-02       HQQNQNRVWWQILLFLHNLALNGEENRNGAGPR-----------------
H2Q6Y8_HRK-01           ----------------------------------------LAAWLLGRRN
H2QLU7_BIK-01           LKENIMRFWRSPNPGSWVSREQVLLALLLLLALLLPLLSGGLHLLLK---
A0A2I3TBK7_BAD-01       ALGSHLEYGRKYFPQAYAKRGSV-----------LSPLEGGLTPIPFRCV
A0A2I3TBK7_BAD-03       GRRTTKGWGR--SPAPFGAARAR-----------RPPTSGQHSAMAASSG
A0A2I3TBK7_BAD-02       QMRQSSSWTR--VFQSWWDRNLG-----------RGSSAPSQ--------
A0A2I3RGH5_BBC3-05      --------------------------------------------------
A0A2I3RGH5_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2I3SX38_PMAIP1-      LRNLTASKTCMRGLLQKSFLRRCTFHQFEERLHCNW--------------
A0A2I3SN61_BCL2L11      LRRIGDEFNAYYARRLAKLLASST--------------------------
A0A2I3SN61_BCL2L11      LRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH---
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      LRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH---
A0A2I3SN61_BCL2L11      LRRIGDEFNAYYARRMPLPPD-----------------------------
A0A2I3SN61_BCL2L11      LRRIGDEFNAYYARRLEK--------------------------------
A0A2I3SN61_BCL2L11      LDLYGHHHSQDAEQLNHKDFS-----------------------------
A0A2I3SN61_BCL2L11      ----------------HREVQWPLKWLAKSS-------------------
                                                                          

A0A2I3SX38_PMAIP1-      -
A0A2I3RGH5_BBC3-02      -
A0A2I3RGH5_BBC3-04      -
A0A2J8QDD5_BMF-01       -
A0A2J8QDD5_BMF-02       -
H2Q6Y8_HRK-01           L
H2QLU7_BIK-01           -
A0A2I3TBK7_BAD-01       -
A0A2I3TBK7_BAD-03       G
A0A2I3TBK7_BAD-02       -
A0A2I3RGH5_BBC3-05      -
A0A2I3RGH5_BBC3-01      -
A0A2I3RGH5_BBC3-03      -
A0A2I3SX38_PMAIP1-      -
A0A2I3SN61_BCL2L11      -
A0A2I3SN61_BCL2L11      -
A0A2I3SN61_BCL2L11      -
A0A2I3SN61_BCL2L11      -
A0A2I3SN61_BCL2L11      -
A0A2I3SN61_BCL2L11      -
A0A2I3SN61_BCL2L11      -
A0A2I3SN61_BCL2L11      -
A0A2I3SN61_BCL2L11      -
A0A2I3SN61_BCL2L11      -
                         

© 1998-2020Legal notice