Dataset for protein classical BH3-containing proteins of organism Pan troglodytes

[Download (right click)] [Edit] [Sequences] [Repertoires]

24 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2I3RGH5_BBC3-04      ---------------------------------------MKFGMGSAQAC
A0A2I3RGH5_BBC3-02      ---------------------------------------MKFGMGSAQAC
A0A2J8QDD5_BMF-01       ----------------------------------MEPSQCVEELEDDVFQ
A0A2J8QDD5_BMF-02       ----------------------------------MEPSQCVEELEDDVFQ
H2Q6Y8_HRK-01           ------------------------------------------------MC
A0A2I3RGH5_BBC3-05      ---------------------------------------MKFGMGSAQAC
H2QLU7_BIK-01           --------------------------------------------------
A0A2I3TBK7_BAD-02       --------------------------------------------------
A0A2I3TBK7_BAD-03       --------------------------------------------------
A0A2I3TBK7_BAD-01       --------------------------------------------------
A0A2I3RGH5_BBC3-03      ---------------------------------------MKFGMGSAQAC
A0A2I3RGH5_BBC3-01      MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAA
A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2I3S5F6_BCL2L11      ----------------------------------------------MAKQ
A0A2I3S5F6_BCL2L11      ----------------------------------------------MAKQ
A0A2I3S5F6_BCL2L11      ----------------------------------------------MAKQ
A0A2I3S5F6_BCL2L11      ----------------------------------------------MAKQ
A0A2I3S5F6_BCL2L11      ----------------------------------------------MAKQ
A0A2I3S5F6_BCL2L11      ----------------------------------------------MAKQ
A0A2I3S5F6_BCL2L11      ----------------------------------------------MAKQ
A0A2I3S5F6_BCL2L11      ----------------------------------------------MAKQ
A0A2I3S5F6_BCL2L11      ----------------------------------------------MAKQ
A0A2I3S5F6_BCL2L11      ----------------------------------------------MAKQ
                                                                          

A0A2I3SX38_PMAIP1-      -----------------------------------------MPGKKARKN
A0A2I3RGH5_BBC3-04      PCQVPRA-------------------ASATWVPCQICGPRERHGPRTPGG
A0A2I3RGH5_BBC3-02      PCQVPRA-------------------ASATWVPCQICGPRERHGPRTPGG
A0A2J8QDD5_BMF-01       PEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQE
A0A2J8QDD5_BMF-02       PEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQE
H2Q6Y8_HRK-01           PCPLHRG------------------------------------------R
A0A2I3RGH5_BBC3-05      PCQVPRA---------------------ASATWVPCQICETRGAAAAPPL
H2QLU7_BIK-01           -------------------------------------------MSEVRPL
A0A2I3TBK7_BAD-02       -------------------------------------------MFQIPEF
A0A2I3TBK7_BAD-03       -------------------------------------------MFQIPEF
A0A2I3TBK7_BAD-01       -------------------------------------------MFQIPEF
A0A2I3RGH5_BBC3-03      PCQVPRA--ASATWVPCQIC---------------------GPQPSLSLA
A0A2I3RGH5_BBC3-01      PTLLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSLA
A0A2I3SX38_PMAIP1-      -----------------------------------------MPGKKARKN
A0A2I3S5F6_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2I3S5F6_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2I3S5F6_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2I3S5F6_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2I3S5F6_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2I3S5F6_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2I3S5F6_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2I3S5F6_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2I3S5F6_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2I3S5F6_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
                                                                          

A0A2I3SX38_PMAIP1-      AQPSPARAPAELE-------------------------------------
A0A2I3RGH5_BBC3-04      QLPGARRGPGPRR-----PAPLPARPPGALGSVLRPLRARPGCRPRRPHP
A0A2I3RGH5_BBC3-02      QLPGARRGPGPRR-----PAPLPARPPGALGSVLRPLRARPGCRPRRPHP
A0A2J8QDD5_BMF-01       DKATQTLSPASPSQGVMLPCGVTEEPQRL---------------------
A0A2J8QDD5_BMF-02       DKATQTLSPASPSQGVMLPCGVTEEPQRL---------------------
H2Q6Y8_HRK-01           DPPAVCACSAGRL-------GLRSSAA-----------------------
A0A2I3RGH5_BBC3-05      ALEGPVQSHHGTP-------ALTQGPQSP---------------------
H2QLU7_BIK-01           SRDILMETLLYEQ-------LLEPPTME----------------------
A0A2I3TBK7_BAD-02       EPSEQEDSSSAER-------GLGPSPAGD---------------------
A0A2I3TBK7_BAD-03       EPSEQEDSSSAER-------GLGPSPAGD---------------------
A0A2I3TBK7_BAD-01       EPSEQEDSSSAER-------GLGPSPAGD---------------------
A0A2I3RGH5_BBC3-03      EQHLESPVPSAPG-------ALAGGPTQA---------------------
A0A2I3RGH5_BBC3-01      EQHLESPVPSAPG-------ALAGGPTQA---------------------
A0A2I3SX38_PMAIP1-      AQPSPARAPAGPA-------GTARDQAGF---------------------
A0A2I3S5F6_BCL2L11      ERPPQLR-PGAPT-------SLQTEPQ-----------------------
A0A2I3S5F6_BCL2L11      ERPPQLR-PGAPT-------SLQTEPQ-----------------------
A0A2I3S5F6_BCL2L11      ERPPQLR-PGAPT-------SLQTEPQ-----------------------
A0A2I3S5F6_BCL2L11      ERPPQLR-PGAPT-------SLQTEPQ-----------------------
A0A2I3S5F6_BCL2L11      ERPPQLR-PGAPT-------SLQTEPQGN---------------------
A0A2I3S5F6_BCL2L11      ERPPQLR-PGAPT-------SLQTEPQGN---------------------
A0A2I3S5F6_BCL2L11      ERPPQLR-PGAPT-------SLQTEPQGN---------------------
A0A2I3S5F6_BCL2L11      ERPPQLR-PGAPT-------SLQTEPQGN---------------------
A0A2I3S5F6_BCL2L11      ERPPQLR-PGAPT-------SLQTEPQGN---------------------
A0A2I3S5F6_BCL2L11      ERPPQLR-PGAPT-------SLQTEPQGN---------------------
                                                                          

A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2I3RGH5_BBC3-04      AARCLPLRPHRPTRRHRRPGGSPLAWGSPQPAPRPAPGRAGDSEELEKSS
A0A2I3RGH5_BBC3-02      AARCLPLRPHRPTRRHRRPGGSPLAWGSPQPAPRPAPGR---------SS
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2J8QDD5_BMF-02       --------------------------------------------------
H2Q6Y8_HRK-01           --------------------------------------------------
A0A2I3RGH5_BBC3-05      --------------------------------------------------
H2QLU7_BIK-01           --------------------------------------------------
A0A2I3TBK7_BAD-02       --------------------------------------------------
A0A2I3TBK7_BAD-03       --------------------------------------------------
A0A2I3TBK7_BAD-01       --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2I3RGH5_BBC3-01      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
                                                                          

A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2I3RGH5_BBC3-04      ALALAGGAAPGVARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPAAAD
A0A2I3RGH5_BBC3-02      ALALAGGAAPGVARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPAAAD
A0A2J8QDD5_BMF-01       ------------------------------------------FYAPAEPK
A0A2J8QDD5_BMF-02       ------------------------------------------FYGNAGYR
H2Q6Y8_HRK-01           --------------------------------------------------
A0A2I3RGH5_BBC3-05      ------------------------------------------RDGAQLGA
H2QLU7_BIK-01           --------------------------------------------------
A0A2I3TBK7_BAD-02       ------------------------------------------GPSGSGKH
A0A2I3TBK7_BAD-03       ------------------------------------------GPSGSGKH
A0A2I3TBK7_BAD-01       ------------------------------------------GPSGSGKH
A0A2I3RGH5_BBC3-03      ------------------------------------------APGVRGEE
A0A2I3RGH5_BBC3-01      ------------------------------------------APGVRGEE
A0A2I3SX38_PMAIP1-      ------------------------------------------GIG-----
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      ------------------------------------------PEGNHGGE
A0A2I3S5F6_BCL2L11      ------------------------------------------PEGNHGGE
A0A2I3S5F6_BCL2L11      ------------------------------------------PEGNHGGE
A0A2I3S5F6_BCL2L11      ------------------------------------------PEGNHGGE
A0A2I3S5F6_BCL2L11      ------------------------------------------PEGNHGGE
A0A2I3S5F6_BCL2L11      ------------------------------------------PEGNHGGE
                                                                          

A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2I3RGH5_BBC3-04      GGRPQRAVRAAETRGAAAAPPLALEGPVQSHHGTPALTQGPQSPRDGAQL
A0A2I3RGH5_BBC3-02      GGRPQRAVRAAETRGAAAAPPLALEGPVQSHHGTPALTQGPQSPRDGAQL
A0A2J8QDD5_BMF-01       SCVVADPPL-------PAQPCFEWRREQ----------------------
A0A2J8QDD5_BMF-02       LPLPASFPAVLPIGEQPPEGQWQHRAEV----------------------
H2Q6Y8_HRK-01           --------------------------------------QLTAARLKALGD
A0A2I3RGH5_BBC3-05      --------------------------------------------------
H2QLU7_BIK-01           -------VLGVTDSEEDLDPMEDFD-------SLECMEGSDALALRL---
A0A2I3TBK7_BAD-02       HRQAPGLLWDASHQQEQPTSSSHHGGAGAV--EIRSRHSSYPAG------
A0A2I3TBK7_BAD-03       HRQAPGLLWDASHQQEQPTSSSHHGGRTSYSPSWESEDSENPSAGML---
A0A2I3TBK7_BAD-01       HRQAPGLLWDASHQQEQPTSSSHHGEGTS---SPEERGHSNPDAAKLQLD
A0A2I3RGH5_BBC3-03      EQWAREIGAQLRRMADDLNAQYERRRQE----------------------
A0A2I3RGH5_BBC3-01      EQWAREIGAQLRRMADDLNAQYERRRQE----------------------
A0A2I3SX38_PMAIP1-      ------------------------------------MQLRFTRGKKLLSS
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDT
A0A2I3S5F6_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDT
A0A2I3S5F6_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDT
A0A2I3S5F6_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDT
A0A2I3S5F6_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDT
A0A2I3S5F6_BCL2L11      GDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDT
                                                                          

A0A2I3SX38_PMAIP1-      ------VECATQLRRFGDKLNFRQKLLNLISKLFCSGT------------
A0A2I3RGH5_BBC3-04      GACTRPVDVRDSGGRPLPPPDTLASAGDFLCTM-----------------
A0A2I3RGH5_BBC3-02      GACTRPVDVRDSGGRPLPPPDTLASAGDFLCTM-----------------
A0A2J8QDD5_BMF-01       -------------------------------------------ERGRP--
A0A2J8QDD5_BMF-02       -------------------------------------------QIARKLQ
H2Q6Y8_HRK-01           ELHQRTMWRRRARSRRAPAPGALPTYWPWLC------------AAAQVAA
A0A2I3RGH5_BBC3-05      --CTRPVDVRDSGGRPLPPPDTLASAGDFLCTM-----------------
H2QLU7_BIK-01           ----ACIGDEMDVSLRAPRLAQLSD------------------VAMHSLG
A0A2I3TBK7_BAD-02       --------TEDDEGMGEEPSPFRGR------------------SRSAPPN
A0A2I3TBK7_BAD-03       --------AEASAGMSAPAADSEAQHAENVKLEALGLWRSGVATAPTPRG
A0A2I3TBK7_BAD-01       ASLPVLVGSELGQGKLRPLPVTFAPHPE---------------TPPVPTA
A0A2I3RGH5_BBC3-03      ---------EQQRHRPSPWRVLYNLIMGLLPLP----------RGHRAPE
A0A2I3RGH5_BBC3-01      ---------EQQRHRPSPWRVLYNLIMGLLPLP----------RGHRAPE
A0A2I3SX38_PMAIP1-      SLSSWPLALPRGHEEQVQVAGSRVCYSTQEIWR----------QTELPAE
A0A2I3S5F6_BCL2L11      ------------------------------ASM----------RQAEPAD
A0A2I3S5F6_BCL2L11      DRSPAPMSCDKSTQTPSPPCQAFNHYLSAM--------------DDSAGS
A0A2I3S5F6_BCL2L11      DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVI----------LEDIGDL
A0A2I3S5F6_BCL2L11      DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASM----------RQAEPAD
A0A2I3S5F6_BCL2L11      DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIF----------E------
A0A2I3S5F6_BCL2L11      DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANW----------D------
A0A2I3S5F6_BCL2L11      DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVRE----------IEEVVV-
A0A2I3S5F6_BCL2L11      DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASM----------RQAEPAD
A0A2I3S5F6_BCL2L11      DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASM----------RQAEPAD
A0A2I3S5F6_BCL2L11      DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASM----------RQAEPAD
                                                                          

A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2I3RGH5_BBC3-04      --------------------------------------------------
A0A2I3RGH5_BBC3-02      --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2J8QDD5_BMF-02       CIADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNGAGPR----
H2Q6Y8_HRK-01           LAAWLLGRRNL---------------------------------------
A0A2I3RGH5_BBC3-05      --------------------------------------------------
H2QLU7_BIK-01           LAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSREQVLLA
A0A2I3TBK7_BAD-02       LWAAQRYGRELRRMSDEFVDSF-KKGLP-----RPKSAGTATQMRQSSSW
A0A2I3TBK7_BAD-03       RRTTKGWGRS--------PAPFGAARAR-----RPPTSGQHSAMAASSGG
A0A2I3TBK7_BAD-01       LGSHLEYGRKY------FPQAYAKRGSV-----LSPLEGGLTPIPFRCV-
A0A2I3RGH5_BBC3-03      MEPN----------------------------------------------
A0A2I3RGH5_BBC3-01      MEPN----------------------------------------------
A0A2I3SX38_PMAIP1-      TSESDIQTLLLRNLTASKTCMRGLLQKSFLRRCTFHQFEERLHCNW----
A0A2I3S5F6_BCL2L11      MRPEIWIAQELRRIGDEFNAYYARRLAKLLASST----------------
A0A2I3S5F6_BCL2L11      SLRIAL--------------------HREVQWPLKWLAKSS---------
A0A2I3S5F6_BCL2L11      SLCFGFIFTGLDLYGHHHSQDAEQLNHKDFS-------------------
A0A2I3S5F6_BCL2L11      MRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIV
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      MRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIV
A0A2I3S5F6_BCL2L11      MRPEIWIAQELRRIGDEFNAYYARRLEK----------------------
A0A2I3S5F6_BCL2L11      MRPEIWIAQELRRIGDEFNAYYARRMPLPPD-------------------
                                                                          

A0A2I3SX38_PMAIP1-      ---------------------
A0A2I3RGH5_BBC3-04      ---------------------
A0A2I3RGH5_BBC3-02      ---------------------
A0A2J8QDD5_BMF-01       ---------------------
A0A2J8QDD5_BMF-02       ---------------------
H2Q6Y8_HRK-01           ---------------------
A0A2I3RGH5_BBC3-05      ---------------------
H2QLU7_BIK-01           LLLLLALLLPLLSGGLHLLLK
A0A2I3TBK7_BAD-02       TRVFQSWWDRNLGRGSSAPSQ
A0A2I3TBK7_BAD-03       ---------------------
A0A2I3TBK7_BAD-01       ---------------------
A0A2I3RGH5_BBC3-03      ---------------------
A0A2I3RGH5_BBC3-01      ---------------------
A0A2I3SX38_PMAIP1-      ---------------------
A0A2I3S5F6_BCL2L11      ---------------------
A0A2I3S5F6_BCL2L11      ---------------------
A0A2I3S5F6_BCL2L11      ---------------------
A0A2I3S5F6_BCL2L11      RLVWRMH--------------
A0A2I3S5F6_BCL2L11      ---------------------
A0A2I3S5F6_BCL2L11      ---------------------
A0A2I3S5F6_BCL2L11      ---------------------
A0A2I3S5F6_BCL2L11      RLVWRMH--------------
A0A2I3S5F6_BCL2L11      ---------------------
A0A2I3S5F6_BCL2L11      ---------------------
                                             

© 1998-2021Legal notice