Dataset for protein classical BH3-containing proteins of organism Pan troglodytes

[Download (right click)] [Edit] [Sequences] [Repertoires]

24 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2I3RGH5_BBC3-02      ---------------------------------------MKFGMGSAQAC
A0A2I3RGH5_BBC3-04      ---------------------------------------MKFGMGSAQAC
H2Q6Y8_HRK-01           ------------------------------------------------MC
A0A2I3RGH5_BBC3-05      ---------------------------------------MKFGMGSAQAC
H2QLU7_BIK-01           --------------------------------------------------
A0A2I3TBK7_BAD-02       --------------------------------------------------
A0A2I3TBK7_BAD-01       --------------------------------------------------
A0A2I3TBK7_BAD-03       --------------------------------------------------
A0A2J8QDD5_BMF-01       ------------------------------------------------ME
A0A2I3RGH5_BBC3-03      ---------------------------------------MKFGMGSAQAC
A0A2I3RGH5_BBC3-01      MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAA
A0A2J8QDD5_BMF-02       ------------------------------------------------ME
A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2I3S5F6_BCL2L11      ----------------------------------------------MAKQ
A0A2I3S5F6_BCL2L11      ----------------------------------------------MAKQ
A0A2I3S5F6_BCL2L11      ----------------------------------------------MAKQ
A0A2I3S5F6_BCL2L11      ----------------------------------------------MAKQ
A0A2I3S5F6_BCL2L11      ----------------------------------------------MAKQ
A0A2I3S5F6_BCL2L11      ----------------------------------------------MAKQ
A0A2I3S5F6_BCL2L11      ----------------------------------------------MAKQ
A0A2I3S5F6_BCL2L11      ----------------------------------------------MAKQ
A0A2I3S5F6_BCL2L11      ----------------------------------------------MAKQ
A0A2I3S5F6_BCL2L11      ----------------------------------------------MAKQ
                                                                          

A0A2I3SX38_PMAIP1-      -----------------------------------------MPGKKARKN
A0A2I3RGH5_BBC3-02      PCQVPRA--------------ASATWVPCQICGPRERHGPRTPGGQLPGA
A0A2I3RGH5_BBC3-04      PCQVPRA--------------ASATWVPCQICGPRERHGPRTPGGQLPGA
H2Q6Y8_HRK-01           PCPLHRG------------------------------------------R
A0A2I3RGH5_BBC3-05      PCQVPRA---------------------ASATWVPCQICETRGAAAAPPL
H2QLU7_BIK-01           -------------------------------------------MSEVRPL
A0A2I3TBK7_BAD-02       -------------------------------------------MFQIPEF
A0A2I3TBK7_BAD-01       -------------------------------------------MFQIPEF
A0A2I3TBK7_BAD-03       -------------------------------------------MFQIPEF
A0A2J8QDD5_BMF-01       PSQCVEE----------------------------------LEDDVFQPE
A0A2I3RGH5_BBC3-03      PCQVPRA--ASATWVPCQIC---------------------GPQPSLSLA
A0A2I3RGH5_BBC3-01      PTLLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSLA
A0A2J8QDD5_BMF-02       PSQCVEE--------------------------------LEDD--VFQPE
A0A2I3SX38_PMAIP1-      -----------------------------------------MPGKKARKN
A0A2I3S5F6_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2I3S5F6_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2I3S5F6_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2I3S5F6_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2I3S5F6_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2I3S5F6_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2I3S5F6_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2I3S5F6_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2I3S5F6_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2I3S5F6_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
                                                                          

A0A2I3SX38_PMAIP1-      AQPSPARAPAE---------------------------------------
A0A2I3RGH5_BBC3-02      RRGPGPRRPAPLPARPPGALGSVLRPLRARPGCRPRRPHPAARCLPLRPH
A0A2I3RGH5_BBC3-04      RRGPGPRRPAPLPARPPGALGSVLRPLRARPGCRPRRPHPAARCLPLRPH
H2Q6Y8_HRK-01           DPPAVCACSAG---------------------------------------
A0A2I3RGH5_BBC3-05      ALEGPVQSHHG---------------------------------------
H2QLU7_BIK-01           SRDILMETLLY---------------------------------------
A0A2I3TBK7_BAD-02       EPSEQEDSSSA---------------------------------------
A0A2I3TBK7_BAD-01       EPSEQEDSSSA---------------------------------------
A0A2I3TBK7_BAD-03       EPSEQEDSSSA---------------------------------------
A0A2J8QDD5_BMF-01       DGEPVTQ-PGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQED
A0A2I3RGH5_BBC3-03      EQHLESPVPSA---------------------------------------
A0A2I3RGH5_BBC3-01      EQHLESPVPSA---------------------------------------
A0A2J8QDD5_BMF-02       DGEPVTQ-PGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQED
A0A2I3SX38_PMAIP1-      AQPSPARAPAG---------------------------------------
A0A2I3S5F6_BCL2L11      ERPPQLR-PGA---------------------------------------
A0A2I3S5F6_BCL2L11      ERPPQLR-PGA---------------------------------------
A0A2I3S5F6_BCL2L11      ERPPQLR-PGA---------------------------------------
A0A2I3S5F6_BCL2L11      ERPPQLR-PGA---------------------------------------
A0A2I3S5F6_BCL2L11      ERPPQLR-PGA---------------------------------------
A0A2I3S5F6_BCL2L11      ERPPQLR-PGA---------------------------------------
A0A2I3S5F6_BCL2L11      ERPPQLR-PGA---------------------------------------
A0A2I3S5F6_BCL2L11      ERPPQLR-PGA---------------------------------------
A0A2I3S5F6_BCL2L11      ERPPQLR-PGA---------------------------------------
A0A2I3S5F6_BCL2L11      ERPPQLR-PGA---------------------------------------
                                                                          

A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2I3RGH5_BBC3-02      RPTRRHRRPGGSPLAWGSPQPAPRPAPGR---------SSALALAGGAAP
A0A2I3RGH5_BBC3-04      RPTRRHRRPGGSPLAWGSPQPAPRPAPGRAGDSEELEKSSALALAGGAAP
H2Q6Y8_HRK-01           -----------------RLGLRSSAA------------------------
A0A2I3RGH5_BBC3-05      -----------------TPALTQGPQSPR---------------------
H2QLU7_BIK-01           -----------------EQLLEPPTME-----------------------
A0A2I3TBK7_BAD-02       -----------------ERGLGPSPAGDG---------------------
A0A2I3TBK7_BAD-01       -----------------ERGLGPSPAGDG---------------------
A0A2I3TBK7_BAD-03       -----------------ERGLGPSPAGDG---------------------
A0A2J8QDD5_BMF-01       KATQTLSPASPSQGVMLPCGVTEEPQ------------------------
A0A2I3RGH5_BBC3-03      -----------------PGALAGGPTQAA---------------------
A0A2I3RGH5_BBC3-01      -----------------PGALAGGPTQAA---------------------
A0A2J8QDD5_BMF-02       KATQTLSPASPSQGVMLPCGVTEEPQRLF---------------------
A0A2I3SX38_PMAIP1-      -----------------PAGTARDQAGFG---------------------
A0A2I3S5F6_BCL2L11      -----------------PTSLQTEPQ------------------------
A0A2I3S5F6_BCL2L11      -----------------PTSLQTEPQ------------------------
A0A2I3S5F6_BCL2L11      -----------------PTSLQTEPQ------------------------
A0A2I3S5F6_BCL2L11      -----------------PTSLQTEPQ------------------------
A0A2I3S5F6_BCL2L11      -----------------PTSLQTEPQGNP---------------------
A0A2I3S5F6_BCL2L11      -----------------PTSLQTEPQGNP---------------------
A0A2I3S5F6_BCL2L11      -----------------PTSLQTEPQGNP---------------------
A0A2I3S5F6_BCL2L11      -----------------PTSLQTEPQGNP---------------------
A0A2I3S5F6_BCL2L11      -----------------PTSLQTEPQGNP---------------------
A0A2I3S5F6_BCL2L11      -----------------PTSLQTEPQGNP---------------------
                                                                          

A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2I3RGH5_BBC3-02      GVARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPAAADGGRPQRAVRA
A0A2I3RGH5_BBC3-04      GVARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPAAADGGRPQRAVRA
H2Q6Y8_HRK-01           --------------------------------------------------
A0A2I3RGH5_BBC3-05      ---------------------------------DGAQLG-----------
H2QLU7_BIK-01           -----------------------------------------------VLG
A0A2I3TBK7_BAD-02       ---------------------------------PSGSGKHHRQAPGLLWD
A0A2I3TBK7_BAD-01       ---------------------------------PSGSGKHHRQAPGLLWD
A0A2I3TBK7_BAD-03       ---------------------------------PSGSGKHHRQAPGLLWD
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2I3RGH5_BBC3-03      ---------------------------------PGVRGEEEQWAREIGAQ
A0A2I3RGH5_BBC3-01      ---------------------------------PGVRGEEEQWAREIGAQ
A0A2J8QDD5_BMF-02       ---------------------------------YGNAGYRLPLPASFPAV
A0A2I3SX38_PMAIP1-      ---------------------------------IG---------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      ---------------------------------EGNHGGEGDSCPHGSPQ
A0A2I3S5F6_BCL2L11      ---------------------------------EGNHGGEGDSCPHGSPQ
A0A2I3S5F6_BCL2L11      ---------------------------------EGNHGGEGDSCPHGSPQ
A0A2I3S5F6_BCL2L11      ---------------------------------EGNHGGEGDSCPHGSPQ
A0A2I3S5F6_BCL2L11      ---------------------------------EGNHGGEGDSCPHGSPQ
A0A2I3S5F6_BCL2L11      ---------------------------------EGNHGGEGDSCPHGSPQ
                                                                          

A0A2I3SX38_PMAIP1-      --------------------------------------------LEVECA
A0A2I3RGH5_BBC3-02      AETRGAAAAPPLALEGPVQSHHGTPALTQGPQSPRDGAQLGACTRPVDVR
A0A2I3RGH5_BBC3-04      AETRGAAAAPPLALEGPVQSHHGTPALTQGPQSPRDGAQLGACTRPVDVR
H2Q6Y8_HRK-01           ----------------------------QLTAARLKALGDELHQRTMWRR
A0A2I3RGH5_BBC3-05      -----------------------------------------ACTRPVDVR
H2QLU7_BIK-01           VTDSEEDLDPMEDFD-------SLECMEGSDALALRL-------ACIGDE
A0A2I3TBK7_BAD-02       ASHQQEQPTSSSHHGGAGAV--EIRSRHSSYPAG--------------TE
A0A2I3TBK7_BAD-01       ASHQQEQPTSSSHHGEGTS---SPEERGHSNPDAAKLQLDASLPVLVGSE
A0A2I3TBK7_BAD-03       ASHQQEQPTSSSHHGGRTSYSPSWESEDSENPSAGML-----------AE
A0A2J8QDD5_BMF-01       -----------------------------------------RLFYAPAEP
A0A2I3RGH5_BBC3-03      LRRMADDLNAQYERRRQE-------------------------------E
A0A2I3RGH5_BBC3-01      LRRMADDLNAQYERRRQE-------------------------------E
A0A2J8QDD5_BMF-02       LPIGEQPPEGQWQHRAEVQIARKLQCIADQFHR-------------LHVQ
A0A2I3SX38_PMAIP1-      --------------------------MQLRFTRGKKLLSSSLSSWPLALP
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      ----------------------------------------DRSPAPMSCD
A0A2I3S5F6_BCL2L11      ----------------------------------------DRSPAPMSCD
A0A2I3S5F6_BCL2L11      ----------------------------------------DRSPAPMSCD
A0A2I3S5F6_BCL2L11      GPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCD
A0A2I3S5F6_BCL2L11      GPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCD
A0A2I3S5F6_BCL2L11      GPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCD
A0A2I3S5F6_BCL2L11      GPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCD
A0A2I3S5F6_BCL2L11      GPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCD
A0A2I3S5F6_BCL2L11      GPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCD
                                                                          

A0A2I3SX38_PMAIP1-      TQLRRFGDKLNFRQKLLNLISKLFCSGT----------------------
A0A2I3RGH5_BBC3-02      DSGGRPLPPPDTLASAGDFLCTM---------------------------
A0A2I3RGH5_BBC3-04      DSGGRPLPPPDTLASAGDFLCTM---------------------------
H2Q6Y8_HRK-01           RARSRRAPAPGALPTYWPWLC------------AAAQVAALAAWLLGRRN
A0A2I3RGH5_BBC3-05      DSGGRPLPPPDTLASAGDFLCTM---------------------------
H2QLU7_BIK-01           MDVSLRAPRLAQLSD------------------VAMHSLGLAFIYDQTED
A0A2I3TBK7_BAD-02       DDEGMGEEPSPFRGR------------------SRSAPPNLWAAQRYGRE
A0A2I3TBK7_BAD-01       LGQGKLRPLPVTFAPHPE---------------TPPVPTALGSHLEYGRK
A0A2I3TBK7_BAD-03       ASAGMSAPAADSEAQHAENVKLEALGLWRSGVATAPTPRGRRTTKGWGRS
A0A2J8QDD5_BMF-01       KSCVVADPPLPAQPCFEWRREQE----------RGRP-------------
A0A2I3RGH5_BBC3-03      QQRHRPSPWRVLYNLIMGLLPLP----------RGHRAPEMEPN------
A0A2I3RGH5_BBC3-01      QQRHRPSPWRVLYNLIMGLLPLP----------RGHRAPEMEPN------
A0A2J8QDD5_BMF-02       QHQQNQNRVWWQILLFLHNLALN----------GEENRNGAGPR------
A0A2I3SX38_PMAIP1-      RGHEEQVQVAGSRVCYSTQEIWR----------QTELPAETSESDIQTLL
A0A2I3S5F6_BCL2L11      --------------------ASM----------RQAEPADMRPEIWIAQE
A0A2I3S5F6_BCL2L11      KSTQTPSPPCQAFNHYLSAM--------------DDSAGSSLRIAL----
A0A2I3S5F6_BCL2L11      KSTQTPSPPCQAFNHYLSAMVVI----------LEDIGDLSLCFGFIFTG
A0A2I3S5F6_BCL2L11      KSTQTPSPPCQAFNHYLSAMASM----------RQAEPADMRPEIWIAQE
A0A2I3S5F6_BCL2L11      KSTQTPSPPCQAFNHYLSAMVRE----------IEEVVV-----------
A0A2I3S5F6_BCL2L11      KSTQTPSPPCQAFNHYLSAMANW----------D----------------
A0A2I3S5F6_BCL2L11      KSTQTPSPPCQAFNHYLSAMGIF----------E----------------
A0A2I3S5F6_BCL2L11      KSTQTPSPPCQAFNHYLSAMASM----------RQAEPADMRPEIWIAQE
A0A2I3S5F6_BCL2L11      KSTQTPSPPCQAFNHYLSAMASM----------RQAEPADMRPEIWIAQE
A0A2I3S5F6_BCL2L11      KSTQTPSPPCQAFNHYLSAMASM----------RQAEPADMRPEIWIAQE
                                                                          

A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2I3RGH5_BBC3-02      --------------------------------------------------
A0A2I3RGH5_BBC3-04      --------------------------------------------------
H2Q6Y8_HRK-01           L-------------------------------------------------
A0A2I3RGH5_BBC3-05      --------------------------------------------------
H2QLU7_BIK-01           IRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSREQVLLALLLLLALLLP
A0A2I3TBK7_BAD-02       LRRMSDEFVDSF-KKGLP-----RPKSAGTATQMRQSSSWTRVFQSWWDR
A0A2I3TBK7_BAD-01       Y------FPQAYAKRGSV-----LSPLEGGLTPIPFRCV-----------
A0A2I3TBK7_BAD-03       --------PAPFGAARAR-----RPPTSGQHSAMAASSGG----------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2I3RGH5_BBC3-01      --------------------------------------------------
A0A2J8QDD5_BMF-02       --------------------------------------------------
A0A2I3SX38_PMAIP1-      LRNLTASKTCMRGLLQKSFLRRCTFHQFEERLHCNW--------------
A0A2I3S5F6_BCL2L11      LRRIGDEFNAYYARRLAKLLASST--------------------------
A0A2I3S5F6_BCL2L11      ----------------HREVQWPLKWLAKSS-------------------
A0A2I3S5F6_BCL2L11      LDLYGHHHSQDAEQLNHKDFS-----------------------------
A0A2I3S5F6_BCL2L11      LRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH---
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      LRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH---
A0A2I3S5F6_BCL2L11      LRRIGDEFNAYYARRLEK--------------------------------
A0A2I3S5F6_BCL2L11      LRRIGDEFNAYYARRMPLPPD-----------------------------
                                                                          

A0A2I3SX38_PMAIP1-      -----------
A0A2I3RGH5_BBC3-02      -----------
A0A2I3RGH5_BBC3-04      -----------
H2Q6Y8_HRK-01           -----------
A0A2I3RGH5_BBC3-05      -----------
H2QLU7_BIK-01           LLSGGLHLLLK
A0A2I3TBK7_BAD-02       NLGRGSSAPSQ
A0A2I3TBK7_BAD-01       -----------
A0A2I3TBK7_BAD-03       -----------
A0A2J8QDD5_BMF-01       -----------
A0A2I3RGH5_BBC3-03      -----------
A0A2I3RGH5_BBC3-01      -----------
A0A2J8QDD5_BMF-02       -----------
A0A2I3SX38_PMAIP1-      -----------
A0A2I3S5F6_BCL2L11      -----------
A0A2I3S5F6_BCL2L11      -----------
A0A2I3S5F6_BCL2L11      -----------
A0A2I3S5F6_BCL2L11      -----------
A0A2I3S5F6_BCL2L11      -----------
A0A2I3S5F6_BCL2L11      -----------
A0A2I3S5F6_BCL2L11      -----------
A0A2I3S5F6_BCL2L11      -----------
A0A2I3S5F6_BCL2L11      -----------
A0A2I3S5F6_BCL2L11      -----------
                                   

© 1998-2022Legal notice