Dataset for protein classical BH3-containing proteins of organism Pan troglodytes

[Download (right click)] [Edit] [Sequences] [Repertoires]

24 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2I3RGH5_BBC3-02      ---------------------------------------MKFGMGSAQAC
A0A2I3RGH5_BBC3-04      ---------------------------------------MKFGMGSAQAC
H2Q6Y8_HRK-01           ------------------------------------------------MC
H2QLU7_BIK-01           ----------------------------------------------MSEV
A0A2I3TBK7_BAD-02       ----------------------------------------------MFQI
A0A2I3TBK7_BAD-01       ----------------------------------------------MFQI
A0A2I3TBK7_BAD-03       ----------------------------------------------MFQI
A0A2I3RGH5_BBC3-05      ---------------------------------------MKFGMGSAQAC
A0A2J8QDD5_BMF-01       ------------------------------------------------ME
A0A2I3RGH5_BBC3-03      ---------------------------------------MKFGMGSAQAC
A0A2I3RGH5_BBC3-01      MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAA
A0A2J8QDD5_BMF-02       ------------------------------------------------ME
A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2I3S5F6_BCL2L11      ----------------------------------------------MAKQ
A0A2I3S5F6_BCL2L11      ----------------------------------------------MAKQ
A0A2I3S5F6_BCL2L11      ----------------------------------------------MAKQ
A0A2I3S5F6_BCL2L11      ----------------------------------------------MAKQ
A0A2I3S5F6_BCL2L11      ----------------------------------------------MAKQ
A0A2I3S5F6_BCL2L11      ----------------------------------------------MAKQ
A0A2I3S5F6_BCL2L11      ----------------------------------------------MAKQ
A0A2I3S5F6_BCL2L11      ----------------------------------------------MAKQ
A0A2I3S5F6_BCL2L11      ----------------------------------------------MAKQ
A0A2I3S5F6_BCL2L11      ----------------------------------------------MAKQ
                                                                          

A0A2I3SX38_PMAIP1-      -----------------------------------------MPGKKARKN
A0A2I3RGH5_BBC3-02      PCQVPRA----------------------ASATWVPCQICGPRERHGPRT
A0A2I3RGH5_BBC3-04      PCQVPRA----------------------ASATWVPCQICGPRERHGPRT
H2Q6Y8_HRK-01           PCPLHRG-------------------------------------------
H2QLU7_BIK-01           RPLSRDI-------------------------------------------
A0A2I3TBK7_BAD-02       PEFEPSE-------------------------------------------
A0A2I3TBK7_BAD-01       PEFEPSE-------------------------------------------
A0A2I3TBK7_BAD-03       PEFEPSE-------------------------------------------
A0A2I3RGH5_BBC3-05      PCQVPRA----------------------ASATWVPCQICETRGAAAAPP
A0A2J8QDD5_BMF-01       PSQCVEE----------------------------------LEDDVFQPE
A0A2I3RGH5_BBC3-03      PCQVPRA--ASATWVPCQIC---------------------GPQPSLSLA
A0A2I3RGH5_BBC3-01      PTLLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSLA
A0A2J8QDD5_BMF-02       PSQCVEE--------------------------------LEDD--VFQPE
A0A2I3SX38_PMAIP1-      -----------------------------------------MPGKKARKN
A0A2I3S5F6_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2I3S5F6_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2I3S5F6_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2I3S5F6_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2I3S5F6_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2I3S5F6_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2I3S5F6_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2I3S5F6_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2I3S5F6_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2I3S5F6_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
                                                                          

A0A2I3SX38_PMAIP1-      ---AQPSPARAPAE------------------------------------
A0A2I3RGH5_BBC3-02      PGGQLPGARRGPGPRRPAPLPARPPGALGSVLRPLRARPGCRPRRPHPAA
A0A2I3RGH5_BBC3-04      PGGQLPGARRGPGPRRPAPLPARPPGALGSVLRPLRARPGCRPRRPHPAA
H2Q6Y8_HRK-01           ---RDPPAVCACSAG-----------------------------------
H2QLU7_BIK-01           ---LMETLLY----------------------------------------
A0A2I3TBK7_BAD-02       ---QEDSSSA----------------------------------------
A0A2I3TBK7_BAD-01       ---QEDSSSA----------------------------------------
A0A2I3TBK7_BAD-03       ---QEDSSSA----------------------------------------
A0A2I3RGH5_BBC3-05      LALEGPVQSH-HGT------------------------------------
A0A2J8QDD5_BMF-01       ---DGEPVTQ-PGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTS
A0A2I3RGH5_BBC3-03      ---EQHLESPVPSA------------------------------------
A0A2I3RGH5_BBC3-01      ---EQHLESPVPSA------------------------------------
A0A2J8QDD5_BMF-02       ---DGEPVTQ-PGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTS
A0A2I3SX38_PMAIP1-      ---AQPSPARAPAG------------------------------------
A0A2I3S5F6_BCL2L11      ---ERPPQLR-PGA------------------------------------
A0A2I3S5F6_BCL2L11      ---ERPPQLR-PGA------------------------------------
A0A2I3S5F6_BCL2L11      ---ERPPQLR-PGA------------------------------------
A0A2I3S5F6_BCL2L11      ---ERPPQLR-PGA------------------------------------
A0A2I3S5F6_BCL2L11      ---ERPPQLR-PGA------------------------------------
A0A2I3S5F6_BCL2L11      ---ERPPQLR-PGA------------------------------------
A0A2I3S5F6_BCL2L11      ---ERPPQLR-PGA------------------------------------
A0A2I3S5F6_BCL2L11      ---ERPPQLR-PGA------------------------------------
A0A2I3S5F6_BCL2L11      ---ERPPQLR-PGA------------------------------------
A0A2I3S5F6_BCL2L11      ---ERPPQLR-PGA------------------------------------
                                                                          

A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2I3RGH5_BBC3-02      RCLPLRPHRPTRRHRRPGGSPLAWGSPQPAPRPAPGR---------SSAL
A0A2I3RGH5_BBC3-04      RCLPLRPHRPTRRHRRPGGSPLAWGSPQPAPRPAPGRAGDSEELEKSSAL
H2Q6Y8_HRK-01           --------------------RLGLRSSAA---------------------
H2QLU7_BIK-01           --------------------EQLLEPPTME--------------------
A0A2I3TBK7_BAD-02       --------------------ERGLGPSPAGDGP-----------------
A0A2I3TBK7_BAD-01       --------------------ERGLGPSPAGDGP-----------------
A0A2I3TBK7_BAD-03       --------------------ERGLGPSPAGDGP-----------------
A0A2I3RGH5_BBC3-05      --------------------P-ALTQGPQSPRD-----------------
A0A2J8QDD5_BMF-01       QEDKATQTLSPASPSQGVMLPCGVTEEPQ---------------------
A0A2I3RGH5_BBC3-03      --------------------PGALAGGPTQAAP-----------------
A0A2I3RGH5_BBC3-01      --------------------PGALAGGPTQAAP-----------------
A0A2J8QDD5_BMF-02       QEDKATQTLSPASPSQGVMLPCGVTEEPQRLFY-----------------
A0A2I3SX38_PMAIP1-      --------------------PAGTARDQAGFGI-----------------
A0A2I3S5F6_BCL2L11      --------------------PTSLQTEPQ---------------------
A0A2I3S5F6_BCL2L11      --------------------PTSLQTEPQ---------------------
A0A2I3S5F6_BCL2L11      --------------------PTSLQTEPQGNPE-----------------
A0A2I3S5F6_BCL2L11      --------------------PTSLQTEPQGNPE-----------------
A0A2I3S5F6_BCL2L11      --------------------PTSLQTEPQGNPE-----------------
A0A2I3S5F6_BCL2L11      --------------------PTSLQTEPQGNPE-----------------
A0A2I3S5F6_BCL2L11      --------------------PTSLQTEPQGNPE-----------------
A0A2I3S5F6_BCL2L11      --------------------PTSLQTEPQGNPE-----------------
A0A2I3S5F6_BCL2L11      --------------------PTSLQTEPQ---------------------
A0A2I3S5F6_BCL2L11      --------------------PTSLQTEPQ---------------------
                                                                          

A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2I3RGH5_BBC3-02      ALAGGAAPGVARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPAAADGG
A0A2I3RGH5_BBC3-04      ALAGGAAPGVARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPAAADGG
H2Q6Y8_HRK-01           --------------------------------------------------
H2QLU7_BIK-01           --------------------------------------------------
A0A2I3TBK7_BAD-02       ------------------------------------------SGSGKHHR
A0A2I3TBK7_BAD-01       ------------------------------------------SGSGKHHR
A0A2I3TBK7_BAD-03       ------------------------------------------SGSGKHHR
A0A2I3RGH5_BBC3-05      ------------------------------------------GAQLG---
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2I3RGH5_BBC3-03      ------------------------------------------GVRGEEEQ
A0A2I3RGH5_BBC3-01      ------------------------------------------GVRGEEEQ
A0A2J8QDD5_BMF-02       ------------------------------------------GNAGYRLP
A0A2I3SX38_PMAIP1-      ------------------------------------------G-------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      ------------------------------------------GNHGGEGD
A0A2I3S5F6_BCL2L11      ------------------------------------------GNHGGEGD
A0A2I3S5F6_BCL2L11      ------------------------------------------GNHGGEGD
A0A2I3S5F6_BCL2L11      ------------------------------------------GNHGGEGD
A0A2I3S5F6_BCL2L11      ------------------------------------------GNHGGEGD
A0A2I3S5F6_BCL2L11      ------------------------------------------GNHGGEGD
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
                                                                          

A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2I3RGH5_BBC3-02      RPQRAVRAAETRGAAAAPPLALEGPVQSHHGTPALTQGPQSPRDGAQLGA
A0A2I3RGH5_BBC3-04      RPQRAVRAAETRGAAAAPPLALEGPVQSHHGTPALTQGPQSPRDGAQLGA
H2Q6Y8_HRK-01           ------------------------------------QLTAARLKALGDEL
H2QLU7_BIK-01           -----VLGVTDSEEDLDPMEDFD-------SLECMEGSDALALRL-----
A0A2I3TBK7_BAD-02       QAPGLLWDASHQQEQPTSSSHHGGAGAV--EIRSRHSSYPAG--------
A0A2I3TBK7_BAD-01       QAPGLLWDASHQQEQPTSSSHHGEGTS---SPEERGHSNPDAAKLQLDAS
A0A2I3TBK7_BAD-03       QAPGLLWDASHQQEQPTSSSHHGGRTSYSPSWESEDSENPSAGML-----
A0A2I3RGH5_BBC3-05      -------------------------------------------------A
A0A2J8QDD5_BMF-01       -------------------------------------------------R
A0A2I3RGH5_BBC3-03      WAREIGAQLRRMADDLNAQYERRRQE------------------------
A0A2I3RGH5_BBC3-01      WAREIGAQLRRMADDLNAQYERRRQE------------------------
A0A2J8QDD5_BMF-02       LPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHR---------
A0A2I3SX38_PMAIP1-      ----------------------------------MQLRFTRGKKLLSSSL
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      ------------------------------------------------DR
A0A2I3S5F6_BCL2L11      SCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDR
A0A2I3S5F6_BCL2L11      SCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDR
A0A2I3S5F6_BCL2L11      SCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDR
A0A2I3S5F6_BCL2L11      SCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDR
A0A2I3S5F6_BCL2L11      SCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDR
A0A2I3S5F6_BCL2L11      SCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDR
A0A2I3S5F6_BCL2L11      ------------------------------------------------DR
A0A2I3S5F6_BCL2L11      ------------------------------------------------DR
                                                                          

A0A2I3SX38_PMAIP1-      --LEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT--------------
A0A2I3RGH5_BBC3-02      CTRPVDVRDSGGRPLPPPDTLASAGDFLCTM-------------------
A0A2I3RGH5_BBC3-04      CTRPVDVRDSGGRPLPPPDTLASAGDFLCTM-------------------
H2Q6Y8_HRK-01           HQRTMWRRRARSRRAPAPGALPTYWPWLC------------AAAQVAALA
H2QLU7_BIK-01           --ACIGDEMDVSLRAPRLAQLSD------------------VAMHSLGLA
A0A2I3TBK7_BAD-02       ------TEDDEGMGEEPSPFRGR------------------SRSAPPNLW
A0A2I3TBK7_BAD-01       LPVLVGSELGQGKLRPLPVTFAPHPE---------------TPPVPTALG
A0A2I3TBK7_BAD-03       ------AEASAGMSAPAADSEAQHAENVKLEALGLWRSGVATAPTPRGRR
A0A2I3RGH5_BBC3-05      CTRPVDVRDSGGRPLPPPDTLASAGDFLCTM-------------------
A0A2J8QDD5_BMF-01       LFYAPAEPKSCVVADPPLPAQPCFEWRREQE----------RGRP-----
A0A2I3RGH5_BBC3-03      -------EQQRHRPSPWRVLYNLIMGLLPLP----------RGHRAPEME
A0A2I3RGH5_BBC3-01      -------EQQRHRPSPWRVLYNLIMGLLPLP----------RGHRAPEME
A0A2J8QDD5_BMF-02       ----LHVQQHQQNQNRVWWQILLFLHNLALN----------GEENRNGAG
A0A2I3SX38_PMAIP1-      SSWPLALPRGHEEQVQVAGSRVCYSTQEIWR----------QTELPAETS
A0A2I3S5F6_BCL2L11      ----------------------------ASM----------RQAEPADMR
A0A2I3S5F6_BCL2L11      SPAPMSCDKSTQTPSPPCQAFNHYLSAMASM----------RQAEPADMR
A0A2I3S5F6_BCL2L11      SPAPMSCDKSTQTPSPPCQAFNHYLSAMASM----------RQAEPADMR
A0A2I3S5F6_BCL2L11      SPAPMSCDKSTQTPSPPCQAFNHYLSAMVRE----------IEEVVV---
A0A2I3S5F6_BCL2L11      SPAPMSCDKSTQTPSPPCQAFNHYLSAMANW----------D--------
A0A2I3S5F6_BCL2L11      SPAPMSCDKSTQTPSPPCQAFNHYLSAMGIF----------E--------
A0A2I3S5F6_BCL2L11      SPAPMSCDKSTQTPSPPCQAFNHYLSAMASM----------RQAEPADMR
A0A2I3S5F6_BCL2L11      SPAPMSCDKSTQTPSPPCQAFNHYLSAMASM----------RQAEPADMR
A0A2I3S5F6_BCL2L11      SPAPMSCDKSTQTPSPPCQAFNHYLSAMVVI----------LEDIGDLSL
A0A2I3S5F6_BCL2L11      SPAPMSCDKSTQTPSPPCQAFNHYLSAM--------------DDSAGSSL
                                                                          

A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2I3RGH5_BBC3-02      --------------------------------------------------
A0A2I3RGH5_BBC3-04      --------------------------------------------------
H2Q6Y8_HRK-01           AWLLGRRNL-----------------------------------------
H2QLU7_BIK-01           FIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSREQVLLALL
A0A2I3TBK7_BAD-02       AAQRYGRELRRMSDEFVDSF-KKGLP-----RPKSAGTATQMRQSSSWTR
A0A2I3TBK7_BAD-01       SHLEYGRKY------FPQAYAKRGSV-----LSPLEGGLTPIPFRCV---
A0A2I3TBK7_BAD-03       TTKGWGRS--------PAPFGAARAR-----RPPTSGQHSAMAASSGG--
A0A2I3RGH5_BBC3-05      --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2I3RGH5_BBC3-03      PN------------------------------------------------
A0A2I3RGH5_BBC3-01      PN------------------------------------------------
A0A2J8QDD5_BMF-02       PR------------------------------------------------
A0A2I3SX38_PMAIP1-      ESDIQTLLLRNLTASKTCMRGLLQKSFLRRCTFHQFEERLHCNW------
A0A2I3S5F6_BCL2L11      PEIWIAQELRRIGDEFNAYYARRLAKLLASST------------------
A0A2I3S5F6_BCL2L11      PEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRL
A0A2I3S5F6_BCL2L11      PEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRL
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      PEIWIAQELRRIGDEFNAYYARRMPLPPD---------------------
A0A2I3S5F6_BCL2L11      PEIWIAQELRRIGDEFNAYYARRLEK------------------------
A0A2I3S5F6_BCL2L11      CFGFIFTGLDLYGHHHSQDAEQLNHKDFS---------------------
A0A2I3S5F6_BCL2L11      RIAL--------------------HREVQWPLKWLAKSS-----------
                                                                          

A0A2I3SX38_PMAIP1-      -------------------
A0A2I3RGH5_BBC3-02      -------------------
A0A2I3RGH5_BBC3-04      -------------------
H2Q6Y8_HRK-01           -------------------
H2QLU7_BIK-01           LLLALLLPLLSGGLHLLLK
A0A2I3TBK7_BAD-02       VFQSWWDRNLGRGSSAPSQ
A0A2I3TBK7_BAD-01       -------------------
A0A2I3TBK7_BAD-03       -------------------
A0A2I3RGH5_BBC3-05      -------------------
A0A2J8QDD5_BMF-01       -------------------
A0A2I3RGH5_BBC3-03      -------------------
A0A2I3RGH5_BBC3-01      -------------------
A0A2J8QDD5_BMF-02       -------------------
A0A2I3SX38_PMAIP1-      -------------------
A0A2I3S5F6_BCL2L11      -------------------
A0A2I3S5F6_BCL2L11      VWRMH--------------
A0A2I3S5F6_BCL2L11      VWRMH--------------
A0A2I3S5F6_BCL2L11      -------------------
A0A2I3S5F6_BCL2L11      -------------------
A0A2I3S5F6_BCL2L11      -------------------
A0A2I3S5F6_BCL2L11      -------------------
A0A2I3S5F6_BCL2L11      -------------------
A0A2I3S5F6_BCL2L11      -------------------
A0A2I3S5F6_BCL2L11      -------------------
                                           

© 1998-2022Legal notice