Dataset for protein Puma of organism Pan troglodytes

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                        : *:.:* *.*  :* *  .:.*  *.  .          
---------------------------------------mkfGmgsAqAcPcqvPrA--asaTwvPcqic-------p--
mararqegsspepveglardgprpfplgrlvpsavscglcep laa p a tll a ylcap ap avtagprerhg-rt
                                                                      alggprw gg

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
p-------------------------------------------------------------------------------
-ggqlpgarrgpgprrpaplparppgalgsvlrplrarpgcrprrphpaarclplrphrptrrhrrpggsplawgspqpa
 rsr                                                                            

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------------------------------------------r--r--e
prpapgragdseelekssalalaggaapgvaraqrpggsggrshpggpgsprgggtvgpgdrgpaaadggrpq-av-aag
                                                                        p gp pd 

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.. : : .   **.** *  *  **: ** ..  *.         ::**  * :        : * .  .    *..   
trgaaaapplaLEgPVqShhGtpALtqGPqsprdGa---------qlGActRpv--------dvRdsggrplppPdtlas
pqpslslaeqh  s  p ap --  ag  tqaap vrgeeeqwarei  ql rmaddlnaqyer rqeeqqrhr spwrv
                                                                                

       330       340   
....:....|....:....|...
  :::  :               
agdflctm---------------
lynlimgllplprghrapemepn
                       
© 1998-2022Legal notice