Dataset for protein Puma of organism Pan troglodytes

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                        : *:.:* *.*  :* *  .:.*  *.  .          
---------------------------------------mkfGmgsAqAcPcqvPrA--asaTwvPcqic-------p--
mararqegsspepveglardgprpfplgrlvpsavscglcep laa p a tll a ylcap ap avtagprerhg-rt
                                                                      alggprw gg

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
p-----g-r--gpqp-------rrpspvpsrppgllgs---ptrarpgvr------prrphpqlrrmplrpnrqyrrrrr
-ggqlp-a-rd--g-slslaeqhlea-l-aa-gaaa-gvlr-lq-a--c-geeeqwa-eigaaa-claddlhapte-h-q
 rsrpr p p   -        ---- - -- ---- -    -- -  -       - ------ ----------- - -

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------spqqrprpspwr----------vlynlimgllp---------------------sprg-------------
pggsplawgee-pah--a-g-agdseelekssala-ag-aa-gvaraqrpggsggrshpggpgl---ggtvgpgdrgpaa
         -- ---  - -           ---- -- --                      -                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                 * :* :  .                                      
-------------etrgaaaapplalegpvqshHgtPaltqgpqsprdgaqlgactrpvdvrdsggrplpppdtlasagd
adggrpqravraa-------------------- ra emepn--------------------------------------
                                                                                

     
....:
     
flctm
-----
     
© 1998-2022Legal notice