Dataset for protein Puma of organism Pan troglodytes

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3RGH5_BBC3-05      ---------------------------------------MKFGMGSAQAC
A0A2I3RGH5_BBC3-02      ---------------------------------------MKFGMGSAQAC
A0A2I3RGH5_BBC3-04      ---------------------------------------MKFGMGSAQAC
A0A2I3RGH5_BBC3-03      ---------------------------------------MKFGMGSAQAC
A0A2I3RGH5_BBC3-01      MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAA
                                                                : *:.:* *.

A0A2I3RGH5_BBC3-05      PCQVPRA--ASATWVPCQIC------------------------------
A0A2I3RGH5_BBC3-02      PCQVPRA--ASATWVPCQICGPRERHGPRTPGGQLPGARR-GPGP-----
A0A2I3RGH5_BBC3-04      PCQVPRA--ASATWVPCQICGPRERHGPRTPGGQLPGARR-GPGP-----
A0A2I3RGH5_BBC3-03      PCQVPRA--ASATWVPCQIC---------------------GPQPSLSLA
A0A2I3RGH5_BBC3-01      PTLLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSLA
                        *  :* *  .:.*  *.  .                              

A0A2I3RGH5_BBC3-05      --------------------------------------------------
A0A2I3RGH5_BBC3-02      --RRPAPLPARPPGALGSVLRPLRARPGCR------PRRPHPAARCLPLR
A0A2I3RGH5_BBC3-04      --RRPAPLPARPPGALGSVLRPLRARPGCR------PRRPHPAARCLPLR
A0A2I3RGH5_BBC3-03      EQHLESPVPSAPGALAGG---PTQAAPGVRGEEEQWAREIGAQLRRMADD
A0A2I3RGH5_BBC3-01      EQHLESPVPSAPGALAGG---PTQAAPGVRGEEEQWAREIGAQLRRMADD
                                                                          

A0A2I3RGH5_BBC3-05      --------------------------------------------------
A0A2I3RGH5_BBC3-02      PHRPTRRHRRPGGSPLAWGSPQPAPRPAPGR---------SSALALAGGA
A0A2I3RGH5_BBC3-04      PHRPTRRHRRPGGSPLAWGSPQPAPRPAPGRAGDSEELEKSSALALAGGA
A0A2I3RGH5_BBC3-03      LNAQYERRRQ---------EEQQRHRPSPWR----------VLYNLIMGL
A0A2I3RGH5_BBC3-01      LNAQYERRRQ---------EEQQRHRPSPWR----------VLYNLIMGL
                                                                          

A0A2I3RGH5_BBC3-05      --------------------------------------------------
A0A2I3RGH5_BBC3-02      APGVARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPAAADGGRPQRAV
A0A2I3RGH5_BBC3-04      APGVARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPAAADGGRPQRAV
A0A2I3RGH5_BBC3-03      LP---------------------LPRG-----------------------
A0A2I3RGH5_BBC3-01      LP---------------------LPRG-----------------------
                                                                          

A0A2I3RGH5_BBC3-05      ---ETRGAAAAPPLALEGPVQSHHGTPALTQGPQSPRDGAQLGACTRPVD
A0A2I3RGH5_BBC3-02      RAAETRGAAAAPPLALEGPVQSHHGTPALTQGPQSPRDGAQLGACTRPVD
A0A2I3RGH5_BBC3-04      RAAETRGAAAAPPLALEGPVQSHHGTPALTQGPQSPRDGAQLGACTRPVD
A0A2I3RGH5_BBC3-03      -----------------------HRAPEMEPN------------------
A0A2I3RGH5_BBC3-01      -----------------------HRAPEMEPN------------------
                                               * :* :  .                  

A0A2I3RGH5_BBC3-05      VRDSGGRPLPPPDTLASAGDFLCTM
A0A2I3RGH5_BBC3-02      VRDSGGRPLPPPDTLASAGDFLCTM
A0A2I3RGH5_BBC3-04      VRDSGGRPLPPPDTLASAGDFLCTM
A0A2I3RGH5_BBC3-03      -------------------------
A0A2I3RGH5_BBC3-01      -------------------------
                                                 

© 1998-2022Legal notice