Dataset for protein Bad of organism Pan troglodytes

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**************************************************************   :   .  .   . * 
MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGgrts---swesrhssnPs
                                                              eggayspepreeghey d
                                                               a  v     d    a

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.              :* . *     .   .                   : ..*    :   :**.          .: 
a--l-----------tElsqGmsrppsvtrarh-e---------------trpvPtnlwttqryGRs-------fpqsf-
ggm-qldaslpvlvgs dge kleelppsfgq-p-nvklealglwrsgvaspst rgrrshlgw  kyrrmsde-vdpyg
 ak            a ada  ga aadfe p a                 a a pa gaake   el        aa a

       170       180       190       200   
....:....|....:....|....:....|....:....|...
      .   *  : :   .                       
krgsvrpptsGtltqmrqssv----------------------
akrlrlskse qhspipfrcswtrvfqswwdrnlgrgssapsq
 a ap   la ga a aa  gg                     
© 1998-2022Legal notice