Dataset for protein Bad of organism Pan troglodytes

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3TBK7_BAD-02      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASH
A0A2I3TBK7_BAD-03      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASH
A0A2I3TBK7_BAD-01      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASH
                       **************************************************

A0A2I3TBK7_BAD-02      QQEQPTSSSHHGGAGAV--EIRSRHSSYPAG--------------TEDDE
A0A2I3TBK7_BAD-03      QQEQPTSSSHHGGRTSYSPSWESEDSENPSAGML-----------AEASA
A0A2I3TBK7_BAD-01      QQEQPTSSSHHGEGTS---SPEERGHSNPDAAKLQLDASLPVLVGSELGQ
                       ************   :   .  .   . * .              :* . 

A0A2I3TBK7_BAD-02      GMGEEPSPFRGR------------------SRSAPPNLWAAQRYGRELRR
A0A2I3TBK7_BAD-03      GMSAPAADSEAQHAENVKLEALGLWRSGVATAPTPRGRRTTKGWGRS---
A0A2I3TBK7_BAD-01      GKLRPLPVTFAPHPE---------------TPPVPTALGSHLEYGRKY--
                       *     .   .                   : ..*    :   :**.   

A0A2I3TBK7_BAD-02      MSDEFVDSF-KKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSA
A0A2I3TBK7_BAD-03      -----PAPFGAARARRPPTSGQHSAMAASSGG------------------
A0A2I3TBK7_BAD-01      ----FPQAYAKRGSVLSPLEGGLTPIPFRCV-------------------
                              .:       .   *  : :   .                    

A0A2I3TBK7_BAD-02      PSQ
A0A2I3TBK7_BAD-03      ---
A0A2I3TBK7_BAD-01      ---
                          

© 1998-2021Legal notice