Dataset for protein Bad of organism Pan troglodytes

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3TBK7_BAD-03      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASH
A0A2I3TBK7_BAD-01      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASH
                       **************************************************

A0A2I3TBK7_BAD-03      QQEQPTSSSHHGGRTSYSPSWESEDSENPSAGML-----------AEASA
A0A2I3TBK7_BAD-01      QQEQPTSSSHHGEGTS---SPEERGHSNPDAAKLQLDASLPVLVGSELGQ
                       ************  **   * *. . .**.*. *           :* . 

A0A2I3TBK7_BAD-03      GMSAPAADSEAQHAENVKLEALGLWRSGVATAPTPRGRRTTKGWGRS--P
A0A2I3TBK7_BAD-01      GKLRPLPVTFAPHPE---------------TPPVPTALGSHLEYGRKYFP
                       *   * . : * *.*               *.*.* .  :   :**.  *

A0A2I3TBK7_BAD-03      APFGAARARRPPTSGQHSAMAASSGG
A0A2I3TBK7_BAD-01      QAYAKRGSVLSPLEGGLTPIPFRCV-
                        .:.   :  .* .*  :.:.  .  

© 1998-2020Legal notice