Dataset for protein classical BH3-containing proteins of organism Pan paniscus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
 f-f-mqeaealpcq-pvfasvtwvgme          vtq--svlgvdhferqptsssplsslqlselthcrssylrgt
 mmer-gcvrinaqdv-rasledgea            c-ivq-rpqitrsalkllldcqhhrstpflvrlrcthgsgtw
 se- p-mrg kmetnlyr   raa             -a-d tqga rmpldfsrgpvlsdghsev tqgap aepqss
   v glk d    pla p                   t e  pgf  geag dtepmkdf halcm ip  h   eaaq
   m  k       k                       e    ca   aa   a d ke     gaa  a         p

        90       100       110       120       130       140       150       160
 a ag hyeed gmg seapeesrmgs  eaanpqqmprtprqev  pggggigkfalellspqvrlrqtqnsrsviedq
      c d   fka ld da nae r     kdnpkkmhcil l  ma  e  ed  dgkmlimgfgpnplplrtga n
                ca    d         iaelagg aae f  e   a       ceaehge amlnhmhqcd  f
                                h  d fe   d                 c da d  khielgi    e
                                f    a                              gggdg f     
                                d                                   eef d       
                                                                    c e         

       170       180       190       200       210     
cnryhkaqhg l hhhllaa  lstrlsqtpikklcka                 
 ip gf nad            gnsneqhnleaf a                   
 hg ad                fmpedpdhg  a                     
 f                      ea l                           
 a                      a  f                           
© 1998-2022Legal notice