Dataset for protein classical BH3-containing proteins of organism Pan paniscus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                           .     .                              
--------------------eps---eell-p-pq-epgervtqprplapaslfaesqqqepptrl-l------------
mkfgmgsamfqipefersaq---svv--c-r-v--pqgpspssknhsqssgrawdqplldcqlssgs-hglthccgpglr
        qsevrqvspmemqdwqsssr-egesralmdakkprslgrpl tldqtglhg-a-gqasqhfpgarrvtrrsk
         acpcplp dikvttdcaqqgdddgftgdvlqgap haqgd md pga e-t-r----rgrqwqleieiqk 
                 a sme vpy i gpqpslslaegvte evds   e a s tvnpgtvlrffilm gaf a   
                   l   llc    e    m    hl   e     a     acm esnh eee a         
                                                           e add  a             
                                                           a                    

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--s-----------gee-q--ml-prvt-------------------------lrs--dlptll-kglpapmscptprqe
rt-ysdsatqtlsr---s-pv--p---aespqrafysyalafiydqtedirpl---ss-fln--kdrs-r-ktadkst--
psgqeskwpyesppasppsgsrpgsgs-yeslwlarrtg           gdksnvvae-f-vit-n-tps-g-----rt
lmasppntesgrrqspnqpaqvracwrvrptdviwqqrs           syaetmrqsy-stwsslvq-gw-swrwlmr
hl eglgsqldegmqhlmdvhsgseflcqmnap mmgpe           qlvrplpmkpylsfrr-imsftrqrqhelq
   dda c hadci d e rglar aa pl  f  han            lhr cfklgivgfdpi fclarphmng gm
         d       a  f       g   e  d l            ee    fd gqd  mg ea  q  gea a 
                    a                e                  e  a a  le     e  fa    

       170       180       190       200       210    
....:....|....:....|....:....|....:....|....:....|....
                                                      
ps--rw------------------------------------------------
--ts-pcqafqhylsamlvrassspqqsvwwqvnwplkwlalsseenrngagpr
rqsls-vrvpnvwwarlhrsqptqnsnrlmrhsllk hn  kng          
vtrkprttsiasqgrlrdlqplqllrlaghlelsgg                  
qniggklsrh plfh naglghlagli agaaiq f                  
kefa  g fe ffed h d  g    h     c  d                  
        c  de                   a                     
                                                      
© 1998-2020Legal notice