Dataset for protein classical BH3-containing proteins of organism Pan paniscus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------makqPsdvssecdregrqlqpaerppqlrpgaptslqtepq---
mfqirplsrdilmetllyeqllepptmkvrkvtqss--fegmeqedssscqrg--a--lgvspagdepsgksklhrlgnp
 sev                   m gkealgnaepepemf gqsaqalead-prf-svtwerctqcqsllgadhpatapl
                                    em-m agcveknpdpv-vagledplgvqilntrvaisaflrslr
                                     drd  klfv  atms sr dkgnfatkl  mqs  rmsg fte
                                      la   k r   q l ad     a  i   lip  gcqe  q 
                                           d       e                gf  f a     
                                                                    d   a       
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------p---p-g----p-s------rs-l-ifmr-ss---rs--------------------------------
egnhggegdsc-hgs-q-plap-a-pgpfat--p-f----r--lls--ssgyfsfpvlvgselsqgmsrppsvtrarhpe
gpvqshsstpgllwdashqqeqatvsshhgpltsyelwrlthcsppglrptsqel       dge kleelppsfgq a 
dkklmshlslsfvylqtshrrgvqtqfsrcgygrvqqspqhercgnptmqddatd       ada  ga aadfe p   
sd al  hlea tqg rediddgpraampvvt tssprwgswnaqatrlgmllna                         
        g   ip  p ae   ll  ad fg lqpnisefilyelakeali                            
             a                ea ek eea e gpde  a                               
                              c  ae       d a                                   
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------drspapmscdkstqtpsppcqafnhylsamasmrq--pa------------------------
nvklealglwrsgvadt------------gr-----------lf--lglp--ae--dmrpeiwiaqelrrigdefnayya
               tatqptslatpsqg--sycgvteepqr--yl----lpplagsstqmlfssvgppvyqwwwrreve
               kypatrrswdvrryvmrwvswrdvlpaaygkrvvynsdvvvglpliaqrgtwtdqpcsqhsqnqq
               srsvrlqrvatqgwrlllrrrsvtyvssmlgprtwkelssptplavrp fsq alg hh d dlg
               qprtl ner hmeqlhqklfmprltlqqgefnprviwktgdqhsrnpl cg   ef f     a 
               llgnc g k ald  gk   le c flp deklnrelhre lfhclgk  e              
                 e     g  k    e        adi a acildgei  eae f a                 
                          e                     hi dc                           
                                                gf                              
                                                ee                              
                                                ac                              

       250       260       270       280       290  
....:....|....:....|....:....|....:....|....:....|..
                                                    
----------------------------------------------------
rrvplpnyqaaedhprmvilrllryivrlvwrmhlhnlalngeenrngagpr
qgrhknvswtqkwrlkvsqhqqnqnr wwqillf                  
illfrqsqsplfhlahsq                                  
 assalpiad                                          
  nk eld                                            
  me df                                             
   a  c                                             
                                                    
                                                    
                                                    
                                                    
© 1998-2021Legal notice