Dataset for protein classical BH3-containing proteins of organism Pan paniscus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-akqpsdvssecdregrqlqpaerppqlrpgaptslqtepq----gnhggeg----dscphgsp----------------
mmfeipefepseqedsssaerglgvspagd-psg-sklhr-gnpe------qqeqlt-s---g-sgtveirsrrtsyspt
 --fgmqsaralpmq-pvfasvtwegvtqcqsllgadhfarapgllwlssh-lfpp-p-sgp-llecm     hs  pgs
  m---gcvq--edpv-ryrqedqa tqi-p---e---a-lslrgcpdarlsekl shmcvhlga a           ag
  smvr---ekn-c tllr kngp  cmeaetrpavsm-t ltldvvqltsr  d nliltqfs                
     gpl -dilq  kk   lae        qf igcql frefplkvnfh    leaellde                
      kk    a    a              g   eape     kkg h          kf c                
                                e   a         d             da a                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------qgplappaspg----rsp--i-mrr-sl-s-----------drspapmscdkstqtpsppcqafnhyl
weseermgsnps-----------pfat---lf-f---s--l-rsssgyfsfdt----v-----a-------------r--
tspddggseealrptsqedsatqtlspaqtsqgwllpvgvtelpqrliytqaeykrt-vrpft-glprglrwrvgyw-wr
s d    h d dasrrrgaqvqpsvvaygseeqvastcppefegladfqnptyrnlglsadvpdpvtqqrqtpstwgssy
            plmgesrktlmvrwvserylrqrqnmlmqlvrmwfdlgnqlpikrrlvtpmrvrlilmgstrstfqqp
             fkedqiplganppl dlrgak eelkdhatdef   dllggacdqek ksqqgh kkfqsmrqtlkm
             ah  lggde dagg aeqa h  diaaa        aa  e  c ah erp fg aeenilplaeig
              a  c   a a  c   g  e   e                        el  a    lhklc  hf
                                                                        aee   a 
                                                                         dc     
                                                                                
                                                                                

       170       180       190       200       210       220       230
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                      
samasmrq--------------------------------------------------------------
-pq-----aepadmrpeiwiaqelrrigdefnayyarrlhlnnyqaaedhprmvilrllryivrlvwrmh
ve-vwwdresvrlslrnrlhvtqpplsqglhwwqassvvfklvswtlkwrnksspr              
r-rsrgsedqglsdqlllfalllsstypshvsqpkrqlnprppqspe nlagag                
nflpianwrvaveaefig  f ghqsn qrtqmlillgmenellng                        
glvqyvlpnrrpa  cha     glqe nqslldfecfga dfd                          
f alvpkkllci    f       d a h  aia        a                           
e  gtiighi g                                                          
d  enfedga d                                                          
a  cleaa                                                              
    hc                                                                
    f                                                                 
© 1998-2022Legal notice