Dataset for protein classical BH3-containing proteins of organism Pan paniscus

[Download (right click)] [Edit] [Sequences] [Repertoires]

20 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2R9AKC9_PMAIP1-      -------------MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLN
A0A2R8ZXD2_BIK-01       -MSEVRPLSRDILMETLLYEQLLEPPTME----------------VLGVT
A0A2R8Z674_BAD-02       -MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSSKHHRQAPGLLWDAS
A0A2R8Z674_BAD-03       -MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSSKHHRQAPGLLWDAS
A0A2R8Z674_BAD-01       -MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSSKHHRQAPGLLWDAS
A0A2R9BS98_BMF-02       --MEPSQCVEELEDD--VFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSR
A0A2R9BS98_BMF-01       --MEPSQCVEELEDD--VFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSR
A0A2R9BZA9_BBC3-02      -MKFGMGSAQACPCQVPRAASVTWVPCQICETRGAAAAPPLALEGPVQSH
A0A2R9BZA9_BBC3-01      -MKFGMGSAQACPCQVPRAASVTWVPCQICGPQPSLSLAEQ---------
A0A2R9AKC9_PMAIP1-      ---MPGKKARKNAQPSPARAPAGPAGTARDQAGFGIGMQLRFTRGKKLLS
A0A2R9BZX9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A2R9BZX9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A2R9BZX9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A2R9BZX9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A2R9BZX9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2R9BZX9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2R9BZX9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2R9BZX9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2R9BZX9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2R9BZX9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
                                                                          

A0A2R9AKC9_PMAIP1-      FRQKLLNLISKLFCSGT---------------------------------
A0A2R8ZXD2_BIK-01       ESEEDLDPMEDFDSLECME------------------GSDALALRLACIG
A0A2R8Z674_BAD-02       HQQEQPTSSSHHGE--------------GTSSPEERGHSNADAAKLQLDA
A0A2R8Z674_BAD-03       HQQEQPTSSSHHGG---------RTSYSPSWESED--SENPSAGMLAEAS
A0A2R8Z674_BAD-01       HQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRS
A0A2R9BS98_BMF-02       LQLFPLTHCCGPGL----------------------------RPTSQEDK
A0A2R9BS98_BMF-01       LQLFPLTHCCGPGL----------------------------RPTSQEDK
A0A2R9BZA9_BBC3-02      HG----TPALTQGP----------------------------QSPRDGAQ
A0A2R9BZA9_BBC3-01      -H----LESPVPSA----------------------------PGALAGGP
A0A2R9AKC9_PMAIP1-      SS----SSSPLALP----------------------------RGHEEQAQ
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      EG----DSCPHGSP----------------------------QGPLAPPA
A0A2R9BZX9_BCL2L11      EG----DSCPHGSP----------------------------QGPLAPPA
A0A2R9BZX9_BCL2L11      EG----DSCPHGSP----------------------------QGPLAPPA
A0A2R9BZX9_BCL2L11      EG----DSCPHGSP----------------------------QGPLAPPA
A0A2R9BZX9_BCL2L11      EG----DSCPHGSP----------------------------QGPLAPPA
A0A2R9BZX9_BCL2L11      EG----DSCPHGSP----------------------------QGPLAPPA
                                                                          

A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2R8ZXD2_BIK-01       DEMDVSLRAPRLAQLSDVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLK
A0A2R8Z674_BAD-02       SLPVLVGSELGQGKLRPLPVTF---------------APHPETPPVPTAL
A0A2R8Z674_BAD-03       AGMSAPAADSEAQHAENVKLEALGLW--------RSGVA---TAPTPRGR
A0A2R8Z674_BAD-01       APPNLWAAQRYGRELRRMSDEFVDSF--------KKGLPRPKSAGTATQM
A0A2R9BS98_BMF-02       ATQTLSPASPSQGVMLPCGVTEEPQRLFYAPAEPKSCVVADPPL------
A0A2R9BS98_BMF-01       ATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGE
A0A2R9BZA9_BBC3-02      L--------------------------------GACTRPVDVRDSGGRPL
A0A2R9BZA9_BBC3-01      TQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQE---EQQRHRPS
A0A2R9AKC9_PMAIP1-      VAGSRVCYSTQEIWRQTELPAETSESDIQTLLLRNLTASKTCMRGLLQKS
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      ---------------------------------DRSPAPMSCDKSTQTPS
A0A2R9BZX9_BCL2L11      ---------------------------------DRSPAPMSCDKSTQTPS
A0A2R9BZX9_BCL2L11      ---------------------------------DRSPAPMSCDKSTQTPS
A0A2R9BZX9_BCL2L11      SPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPS
A0A2R9BZX9_BCL2L11      SPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPS
A0A2R9BZX9_BCL2L11      SPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPS
A0A2R9BZX9_BCL2L11      SPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPS
A0A2R9BZX9_BCL2L11      SPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPS
A0A2R9BZX9_BCL2L11      SPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPS
                                                                          

A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2R8ZXD2_BIK-01       ENIMRFWRSPNPRSWVSREQVLLALLLLLALLLPLLSGGLHLLLK-----
A0A2R8Z674_BAD-02       GSHLEYGRKYFPQAYAKRGSVL-----------SPLEGGLTQIPFRCV--
A0A2R8Z674_BAD-03       RTTKGWGR--SPAPFGAARARR-----------PPTSGQHSAMAASSGG-
A0A2R8Z674_BAD-01       RQSSSWTR--VFQSWWDRNLGR-----------GSSAPSQ----------
A0A2R9BS98_BMF-02       -PAQPCFEWRREQERGRP--------------------------------
A0A2R9BS98_BMF-01       QPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLH
A0A2R9BZA9_BBC3-02      PPPDTLASAGDFLCTM----------------------------------
A0A2R9BZA9_BBC3-01      PWRVLYNLIMGLLPLPRGHRAPEMEPN-----------------------
A0A2R9AKC9_PMAIP1-      FLRRCTFHQFEERLHCNW--------------------------------
A0A2R9BZX9_BCL2L11      -------------ASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLA
A0A2R9BZX9_BCL2L11      PPCQAFNHYLSAM----DDSAGSSLRIAL--------------------H
A0A2R9BZX9_BCL2L11      PPCQAFNHYLSAMVVILEDIGDLSLCFGFIFTGLDLYGHHHSQDAEQLNH
A0A2R9BZX9_BCL2L11      PPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVF
A0A2R9BZX9_BCL2L11      PPCQAFNHYLSAMVREIEEVVV----------------------------
A0A2R9BZX9_BCL2L11      PPCQAFNHYLSAMGIFE---------------------------------
A0A2R9BZX9_BCL2L11      PPCQAFNHYLSAMANWD---------------------------------
A0A2R9BZX9_BCL2L11      PPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVF
A0A2R9BZX9_BCL2L11      PPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRMP
A0A2R9BZX9_BCL2L11      PPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLE
                                                                          

A0A2R9AKC9_PMAIP1-      ------------------------------
A0A2R8ZXD2_BIK-01       ------------------------------
A0A2R8Z674_BAD-02       ------------------------------
A0A2R8Z674_BAD-03       ------------------------------
A0A2R8Z674_BAD-01       ------------------------------
A0A2R9BS98_BMF-02       ------------------------------
A0A2R9BS98_BMF-01       NLALNGEENRNGAGPR--------------
A0A2R9BZA9_BBC3-02      ------------------------------
A0A2R9BZA9_BBC3-01      ------------------------------
A0A2R9AKC9_PMAIP1-      ------------------------------
A0A2R9BZX9_BCL2L11      KLLSST------------------------
A0A2R9BZX9_BCL2L11      REVQWPLKWLAKSS----------------
A0A2R9BZX9_BCL2L11      KDFS--------------------------
A0A2R9BZX9_BCL2L11      LNNYQAAEDHPRMVILRLLRYIVRLVWRMH
A0A2R9BZX9_BCL2L11      ------------------------------
A0A2R9BZX9_BCL2L11      ------------------------------
A0A2R9BZX9_BCL2L11      ------------------------------
A0A2R9BZX9_BCL2L11      LNNYQAAEDHPRMVILRLLRYIVRLVWRMH
A0A2R9BZX9_BCL2L11      LPPD--------------------------
A0A2R9BZX9_BCL2L11      K-----------------------------
                                                      

© 1998-2022Legal notice