Dataset for protein classical BH3-containing proteins of organism Pan paniscus

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2R9AKC9_PMAIP1-      ------------------------------------MPGKKARKNAQPSP
A0A2R8ZXD2_BIK-01       --------MSEVRPLSRDILMETLLYEQLLEP-PTMEVLGVTESEEDLDP
A0A2R8Z688_BAD-03       --------MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSSKHHRQAP
A0A2R8Z688_BAD-01       --------MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSSKHHRQAP
A0A2R9BS98_BMF-02       -------------------MEPSQCVEELEDDVFQPEDGEPVTQPGSLLS
A0A2R9BS98_BMF-01       -------------------MEPSQCVEELEDDVFQPEDGEPVTQPGSLLS
A0A2R9BZA9_BBC3-01      MKFGMGSAQACPCQVPRAASVTWVPCQICGPQPSLSLAEQHLESPVPSAP
A0A2R9C366_BCL2L11      -----------------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAP
A0A2R9AKC9_PMAIP1-      ------------------------------------MPGKKARKNAQPSP
A0A2R9C366_BCL2L11      -----------------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAP
                                                                   .     .

A0A2R9AKC9_PMAIP1-      ARAPAELEVECATQLRRF--------------------------------
A0A2R8ZXD2_BIK-01       MEDFDSLECMEGSDALALRLA---------------------CIGDEMDV
A0A2R8Z688_BAD-03       GLLWDASHQQEQPTSSSHHGG---------RTSYSPSWESED--SENPSA
A0A2R8Z688_BAD-01       GLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSP
A0A2R9BS98_BMF-02       ADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQG
A0A2R9BS98_BMF-01       ADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQG
A0A2R9BZA9_BBC3-01      GALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQR
A0A2R9C366_BCL2L11      TSLQTEPQ------------------------------------------
A0A2R9AKC9_PMAIP1-      ARAPAGPAGTARDQAGFGIGMQLRFTRGKKLLSSSSSSPLALPRGHEEQA
A0A2R9C366_BCL2L11      TSLQTEPQGNPEGNHG----------------GEGDSCPHGSPQGPLAPP
                                                                          

A0A2R9AKC9_PMAIP1-      ------------------------------GDKLNFRQKLLNLISKLFCS
A0A2R8ZXD2_BIK-01       SLRAPRLAQLSDVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMR
A0A2R8Z688_BAD-03       GMLAEASAGMSAPAADSEA-----------QHAENVKLEALGLWRSGVA-
A0A2R8Z688_BAD-01       FRGRSRSAPPNLWAAQRYG-----------RELRRMSDEFVDSFKKGLPR
A0A2R9BS98_BMF-02       VMLPCGVTEEPQRLFYAPA-----------EPKSCVVADPPL-------P
A0A2R9BS98_BMF-01       VMLPCGVTEEPQRLFYGNA-----------GYRLPLPASFPAVLPIGEQP
A0A2R9BZA9_BBC3-01      HRPSPWRV-------------------------------LYNLIMGLLPL
A0A2R9C366_BCL2L11      ---------------------------------------------DRSPA
A0A2R9AKC9_PMAIP1-      QVAGSRVCYSTQEIWRQTE-----------LPAETSESDIQTLLLRNLTA
A0A2R9C366_BCL2L11      ASPGPFATRSPLFIFMRRS-----------SLLSRSSSGYFSFDTDRSPA
                                                                          

A0A2R9AKC9_PMAIP1-      GT------------------------------------------------
A0A2R8ZXD2_BIK-01       FWRSPNPR------SWVSREQVLLALLLLLALLLPLLSGGLHLLLK----
A0A2R8Z688_BAD-03       --TAPTPRGRRTTKGWGRSPAPFGAARARRPPTSGQHSAMAASSGG----
A0A2R8Z688_BAD-01       PKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ-------------
A0A2R9BS98_BMF-02       AQPCFEWRREQERGRP----------------------------------
A0A2R9BS98_BMF-01       PEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNL
A0A2R9BZA9_BBC3-01      PRGHRAPEMEPN--------------------------------------
A0A2R9C366_BCL2L11      PMSCDKSTQTPS--PPCQAFNHYLSAMDDSAGSSLRIALHREVQWPLKWL
A0A2R9AKC9_PMAIP1-      SKTCMRGLLQKSFLRRCTFHQFEERLH---------------CNW-----
A0A2R9C366_BCL2L11      PMSCDKSTQTPS--PPCQAFNHYLSAM---------------ANWD----
                                                                          

A0A2R9AKC9_PMAIP1-      --------------
A0A2R8ZXD2_BIK-01       --------------
A0A2R8Z688_BAD-03       --------------
A0A2R8Z688_BAD-01       --------------
A0A2R9BS98_BMF-02       --------------
A0A2R9BS98_BMF-01       ALNGEENRNGAGPR
A0A2R9BZA9_BBC3-01      --------------
A0A2R9C366_BCL2L11      AKSS----------
A0A2R9AKC9_PMAIP1-      --------------
A0A2R9C366_BCL2L11      --------------
                                      

© 1998-2020Legal notice