Dataset for protein classical BH3-containing proteins of organism Pan paniscus

[Download (right click)] [Edit] [Sequences] [Repertoires]

20 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2R9AKC9_PMAIP1-      -------MPGKKARKNAQPSPARAPA------------ELEVECATQLRR
A0A2R8ZXD2_BIK-01       MSEVRPLSRDILMETLLYEQLLEPPTME----------------VLGVTE
A0A2R8Z674_BAD-02       MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSSKHHRQAPGLLWDASH
A0A2R8Z674_BAD-03       MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSSKHHRQAPGLLWDASH
A0A2R8Z674_BAD-01       MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSSKHHRQAPGLLWDASH
A0A2R9BZA9_BBC3-02      -MKFGMGSAQACPCQVPRAASVTWVP------------CQICETRGAAAA
A0A2R9BS98_BMF-01       --MEPSQCVEELEDD--VFQPEDGEP------------VTQPGSLLSADL
A0A2R9BS98_BMF-02       --MEPSQCVEELEDD--VFQPEDGEP------------VTQPGSLLSADL
A0A2R9BZA9_BBC3-01      -MKFGMGSAQACPCQVPRAASVTWVP------------CQICGPQPSLSL
A0A2R9AKC9_PMAIP1-      ---MPGKKARKNAQPSPARAPAGPAG------------TARDQAGFGIGM
A0A2R9BZX9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPP------------QLRPGAPTSLQT
A0A2R9BZX9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPP------------QLRPGAPTSLQT
A0A2R9BZX9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPP------------QLRPGAPTSLQT
A0A2R9BZX9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPP------------QLRPGAPTSLQT
A0A2R9BZX9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPP------------QLRPGAPTSLQT
A0A2R9BZX9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPP------------QLRPGAPTSLQT
A0A2R9BZX9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPP------------QLRPGAPTSLQT
A0A2R9BZX9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPP------------QLRPGAPTSLQT
A0A2R9BZX9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPP------------QLRPGAPTSLQT
A0A2R9BZX9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPP------------QLRPGAPTSLQT
                                                                          

A0A2R9AKC9_PMAIP1-      FGDKL---------------------------------------------
A0A2R8ZXD2_BIK-01       SEEDLDPMEDFDSLECME------------------GSDALALRLACIGD
A0A2R8Z674_BAD-02       QQEQPTSSSHHGE--------------GTSSPEERGHSNADAAKLQLDAS
A0A2R8Z674_BAD-03       QQEQPTSSSHHGG---------RTSYSPSWESED--SENPSAGMLAEASA
A0A2R8Z674_BAD-01       QQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSA
A0A2R9BZA9_BBC3-02      PPLALEGPVQSHHGTPALTQGPQSP-------------------------
A0A2R9BS98_BMF-01       FAQ-SLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVM
A0A2R9BS98_BMF-02       FAQ-SLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVM
A0A2R9BZA9_BBC3-01      AEQ----------HLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGA
A0A2R9AKC9_PMAIP1-      QLRFTRGKKLLSSSSSSPLALPRGHEEQAQVAGSRVCYSTQEIWRQTELP
A0A2R9BZX9_BCL2L11      EPQ-----------------------------------------------
A0A2R9BZX9_BCL2L11      EPQ-----------------------------------------------
A0A2R9BZX9_BCL2L11      EPQ-----------------------------------------------
A0A2R9BZX9_BCL2L11      EPQ-----------------------------------------------
A0A2R9BZX9_BCL2L11      EPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSL
A0A2R9BZX9_BCL2L11      EPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSL
A0A2R9BZX9_BCL2L11      EPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSL
A0A2R9BZX9_BCL2L11      EPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSL
A0A2R9BZX9_BCL2L11      EPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSL
A0A2R9BZX9_BCL2L11      EPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSL
                                                                          

A0A2R9AKC9_PMAIP1-      ------------NFRQKLLNLISKLFCSGT--------------------
A0A2R8ZXD2_BIK-01       EMDVSLRAPRLAQLSDVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKE
A0A2R8Z674_BAD-02       LPVLVGSELGQGKLRPLPVTF---------------APHPETPPVPTALG
A0A2R8Z674_BAD-03       GMSAPAADSEAQHAENVKLEALGLW--------RSGVA---TAPTPRGRR
A0A2R8Z674_BAD-01       PPNLWAAQRYGRELRRMSDEFVDSF--------KKGLPRPKSAGTATQMR
A0A2R9BZA9_BBC3-02      ------------RDGAQLGACTRPVDVRDSGGRPLPPPDTLASAGDFLCT
A0A2R9BS98_BMF-01       LPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQI
A0A2R9BS98_BMF-02       LPCGVTE-----EPQRLFYAPAEPKSC--VVADPPLPAQPCFEWRREQER
A0A2R9BZA9_BBC3-01      QLRRMAD-----DLNAQYERRRQE---EQQRHRPSPWRVLYNLIMGLLPL
A0A2R9AKC9_PMAIP1-      AETSESD-----IQTLLLRNLTASKTCMRGLLQKSFLRRCTFHQFEERLH
A0A2R9BZX9_BCL2L11      ------------------------------------------------AS
A0A2R9BZX9_BCL2L11      ------------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAM--
A0A2R9BZX9_BCL2L11      ------------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVV
A0A2R9BZX9_BCL2L11      ------------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMAS
A0A2R9BZX9_BCL2L11      LSRSSSG-----YFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMAS
A0A2R9BZX9_BCL2L11      LSRSSSG-----YFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVR
A0A2R9BZX9_BCL2L11      LSRSSSG-----YFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGI
A0A2R9BZX9_BCL2L11      LSRSSSG-----YFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMAN
A0A2R9BZX9_BCL2L11      LSRSSSG-----YFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMAS
A0A2R9BZX9_BCL2L11      LSRSSSG-----YFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMAS
                                                                          

A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2R8ZXD2_BIK-01       NIMRFWRSPNPRSWVSREQVLLALLLLLALLLPLLSGGLHLLLK------
A0A2R8Z674_BAD-02       SHLEYGRKYFPQAYAKRGSVL-----------SPLEGGLTQIPFRCV---
A0A2R8Z674_BAD-03       TTKGWGR--SPAPFGAARARR-----------PPTSGQHSAMAASSGG--
A0A2R8Z674_BAD-01       QSSSWTR--VFQSWWDRNLGR-----------GSSAPSQ-----------
A0A2R9BZA9_BBC3-02      M-------------------------------------------------
A0A2R9BS98_BMF-01       ARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNGAGP
A0A2R9BS98_BMF-02       GRP-----------------------------------------------
A0A2R9BZA9_BBC3-01      PRGHRAPEMEPN--------------------------------------
A0A2R9AKC9_PMAIP1-      CNW-----------------------------------------------
A0A2R9BZX9_BCL2L11      MRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLAKLLSST---------
A0A2R9BZX9_BCL2L11      --DDSAGSSLRIAL--------------------HREVQWPLKWLAKSS-
A0A2R9BZX9_BCL2L11      ILEDIGDLSLCFGFIFTGLDLYGHHHSQDAEQLNHKDFS-----------
A0A2R9BZX9_BCL2L11      MRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVI
A0A2R9BZX9_BCL2L11      MRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVI
A0A2R9BZX9_BCL2L11      EIEEVVV-------------------------------------------
A0A2R9BZX9_BCL2L11      FE------------------------------------------------
A0A2R9BZX9_BCL2L11      WD------------------------------------------------
A0A2R9BZX9_BCL2L11      MRQAEPADMRPEIWIAQELRRIGDEFNAYYARRMPLPPD-----------
A0A2R9BZX9_BCL2L11      MRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLEK--------------
                                                                          

A0A2R9AKC9_PMAIP1-      ---------------
A0A2R8ZXD2_BIK-01       ---------------
A0A2R8Z674_BAD-02       ---------------
A0A2R8Z674_BAD-03       ---------------
A0A2R8Z674_BAD-01       ---------------
A0A2R9BZA9_BBC3-02      ---------------
A0A2R9BS98_BMF-01       R--------------
A0A2R9BS98_BMF-02       ---------------
A0A2R9BZA9_BBC3-01      ---------------
A0A2R9AKC9_PMAIP1-      ---------------
A0A2R9BZX9_BCL2L11      ---------------
A0A2R9BZX9_BCL2L11      ---------------
A0A2R9BZX9_BCL2L11      ---------------
A0A2R9BZX9_BCL2L11      LRLLRYIVRLVWRMH
A0A2R9BZX9_BCL2L11      LRLLRYIVRLVWRMH
A0A2R9BZX9_BCL2L11      ---------------
A0A2R9BZX9_BCL2L11      ---------------
A0A2R9BZX9_BCL2L11      ---------------
A0A2R9BZX9_BCL2L11      ---------------
A0A2R9BZX9_BCL2L11      ---------------
                                       

© 1998-2022Legal notice