Dataset for protein Bad of organism Pan paniscus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
**************************************************************   :       ..    .
                                                               a  seeere  dad ak

        90       100       110       120       130       140       150       160
             * . *     .   .                   : ..*    :   :**.          .:    
lqml-slpvlvgs dge kleelppsfgq-p-nvklealglwrsgvaspst rgrrshlgw  kyrrmsde-vdpygakr
agld          ada  ga aadfe p a                 a a pa gaake   el        aa a a 

       170       180       190       200
   .   *  : :   .                       
lrlskse qhsaipfrcswtrvfqswwdrnlgrgssapsq
ap   la ga   aa  gg                     
© 1998-2022Legal notice