Dataset for protein Bad of organism Pan paniscus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2R8Z688_BAD-03      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSSKHHRQAPGLLWDASH
A0A2R8Z688_BAD-01      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSSKHHRQAPGLLWDASH
                       **************************************************

A0A2R8Z688_BAD-03      QQEQPTSSSHHGG---------RTSYSPSWESED--SENPSAGMLAEASA
A0A2R8Z688_BAD-01      QQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSA
                       *************         .:**... *.::  .*:**.    . **

A0A2R8Z688_BAD-03      GMSAPAADSEAQHAENVKLEALGLWRSGVA---TAPTPRGRRTTKGWGRS
A0A2R8Z688_BAD-01      PPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRV
                         .  **:  ..   .:. * :. :..*:.   :* *.   * :..* * 

A0A2R8Z688_BAD-03      PAPFGAARARRPPTSGQHSAMAASSGG
A0A2R8Z688_BAD-01      FQSWWDRNLGRGSSAPSQ---------
                         .:   .  * .:: .:         

© 1998-2020Legal notice