Dataset for protein classical BH3-containing proteins of organism Otus sunia

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80

        90       100       110       120       130       140       150       160
                                                .        .    * :*. *.*::       
lspssssqdvmlpcgvteeprrlfygnagyrlhvppvgmplrtlrqtesreeqrlrepviqc qk qc a kwhlsyiq-
                                      fagdphlkea paa   ac  ae  le      dalhcp 

       170       180       190       200        
                ..:  :   :*.                    
rvtfifllsislhtasqrkknqlwtq vcpltnlalnaeanrnhtgqr
h               e h      feh                
© 1998-2023Legal notice