Dataset for protein classical BH3-containing proteins of organism Otus sunia

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C8B299_BMF-01       MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A0A8C8AGU8_BCL2L11      --------------------------------------------------
A0A8C8B736_PMAIP1-      --------------------------------------------------
                                                                          

A0A8C8B299_BMF-01       LLGRFQLFPLTHCCGPGIRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
A0A8C8AGU8_BCL2L11      --------------------------------------------------
A0A8C8B736_PMAIP1-      --------------------------------------------------
                                                                          

A0A8C8B299_BMF-01       RRLFYGNAGYRLHVPPVGFALDPHLQEEPREGQREARAEVQIARKLQCIA
A0A8C8AGU8_BCL2L11      ---------------------------FSSYEPALVCPEIWIAQELRRIG
A0A8C8B736_PMAIP1-      ------------------MPGRTLRKTAPPAAPAEREAVAECALQLRRIG
                                                    .        .    * :*. *.

A0A8C8B299_BMF-01       DQFHRLHIQRH---------------QQNRNQVWWQLFLFLHNLALNAEA
A0A8C8AGU8_BCL2L11      DEFNASYCPRRVTFIFLLSISLHTASKREKLNHLWKLVLR----------
A0A8C8B736_PMAIP1-      DKWDL---------------------RQKILNLLTKLFCPET--------
                        *::                       ..:  :   :*.            

A0A8C8B299_BMF-01       NRNHTGQR
A0A8C8AGU8_BCL2L11      --------
A0A8C8B736_PMAIP1-      --------
                                

© 1998-2022Legal notice