Dataset for protein Bmf of organism Oryzias sinensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MDDEEDDVFELDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
***********************************************************.              ::.. :
GQRSPVERSEVPVMGSGEAWSKPQAAKTIIWLLLGVEGRLSANDNNSLINQEGGGAMKDs--------------qvgvfm
                                                           kpqrpqalrlvsflfeldtei

       250     
....:....|....:
:: : :*::.::   
lvsmilSlltnq---
fiffgi iiphdcli
© 1998-2023Legal notice