Dataset for protein Bmf of organism Oryzias sinensis

[Download (right click)] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A8C7XJP0_BMF-01      MDDEEDDVFELDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAE
A0A8C7XJP0_BMF-02      MDDEEDDVFELDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAE
                       **************************************************

A0A8C7XJP0_BMF-01      EPRPLFYGNAGFRLHFPARFELAGDLEVRRHDREAERRGMERLPRQQPVA
A0A8C7XJP0_BMF-02      EPRPLFYGNAGFRLHFPARFELAGDLEVRRHDREAERRGMERLPRQQPVA
                       **************************************************

A0A8C7XJP0_BMF-01      RSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFD
A0A8C7XJP0_BMF-02      RSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFD
                       **************************************************

A0A8C7XJP0_BMF-01      RGFIAGAGGAGQRSPVERSEVPVMGSGEAWSKPQAAKTIIWLLLGVEGRL
A0A8C7XJP0_BMF-02      RGFIAGAGGAGQRSPVERSEVPVMGSGEAWSKPQAAKTIIWLLLGVEGRL
                       **************************************************

A0A8C7XJP0_BMF-01      SANDNNSLINQEGGGAMKDKPQRPQALRLVSFLFQVDTFILVF-MIISII
A0A8C7XJP0_BMF-02      SANDNNSLINQEGGGAMKDSELG------------VEMFISFGLSLLPHQ
                       *******************.               *: ** .   ::.  

A0A8C7XJP0_BMF-01      TND
A0A8C7XJP0_BMF-02      CLI
                          

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice