Dataset for protein Bmf of organism Oryzias sinensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C7XJP0_BMF-01      MDDEEDDVFELDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAE
A0A8C7XJP0_BMF-02      MDDEEDDVFELDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAE
                       **************************************************

A0A8C7XJP0_BMF-01      EPRPLFYGNAGFRLHFPARFELAGDLEVRRHDREAERRGMERLPRQQPVA
A0A8C7XJP0_BMF-02      EPRPLFYGNAGFRLHFPARFELAGDLEVRRHDREAERRGMERLPRQQPVA
                       **************************************************

A0A8C7XJP0_BMF-01      RSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFD
A0A8C7XJP0_BMF-02      RSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFD
                       **************************************************

A0A8C7XJP0_BMF-01      RGFIAGAGGAGQRSPVERSEVPVMGSGEAWSKPQAAKTIIWLLLGVEGRL
A0A8C7XJP0_BMF-02      RGFIAGAGGAGQRSPVERSEVPVMGSGEAWSKPQAAKTIIWLLLGVEGRL
                       **************************************************

A0A8C7XJP0_BMF-01      SANDNNSLINQEGGGAMKDKPQRPQALRLVSFLFQVDTFILVFMIISIIT
A0A8C7XJP0_BMF-02      SANDNNSLINQEGGGAMKDS--------------ELGVEMFISFGLSLLP
                       *******************.              ::.. ::: : :*::.

A0A8C7XJP0_BMF-01      ND---
A0A8C7XJP0_BMF-02      HQCLI
                       ::   

© 1998-2023Legal notice